Recombinant Human WNT16, StrepII-tagged
Cat.No. : | WNT16-243H |
Product Overview : | Purified, full-length human recombinant WNT16 protein (amino acids 30-365, 336 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 37.6 kDa. (Accession NP_476509.1; UniProt Q9UBV4) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 30-365, 336 a.a. |
Description : | Wnt16 is a ligand for members of the frizzled family of seven transmembrane receptors. It may be a signaling molecule which affects the development of discrete regions of tissues. The protein Is likely to signal over only few cell diameters. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | NWMWLGIASFGVPEKLGCANLPLNSRQKELCKRKPYLLPSIREGARLGIQECGSQFRHERWNCMITAAATTAPMGASPLFGYELSSGTKE TAFIYAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFLDFPIGNTTGKENKVLLAMNLHNNEAGRQAVA KLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSE GADGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHTCK |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | WNT16 wingless-type MMTV integration site family, member 16 [ Homo sapiens ] |
Official Symbol | WNT16 |
Synonyms | WNT16; wingless-type MMTV integration site family, member 16; protein Wnt-16; wingless-type MMTV integration site family member 16b; |
Gene ID | 51384 |
mRNA Refseq | NM_016087 |
Protein Refseq | NP_057171 |
MIM | 606267 |
UniProt ID | Q9UBV4 |
Chromosome Location | 7q31 |
Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; HTLV-I infection, organism-specific biosystem; HTLV-I infection, conserved biosystem; |
Function | frizzled binding; receptor binding; |
◆ Recombinant Proteins | ||
WNT16-583H | Recombinant Human WNT16 Protein, His-tagged | +Inquiry |
WNT16-114H | Active Recombinant Human WNT16 Protein | +Inquiry |
WNT16-243H | Recombinant Human WNT16, StrepII-tagged | +Inquiry |
WNT16-5899H | Recombinant Human WNT16 Protein (Asn30-Lys365), N-GST tagged | +Inquiry |
WNT16-1477H | Recombinant Human WNT16 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
WNT16-300HCL | Recombinant Human WNT16 293 Cell Lysate | +Inquiry |
WNT16-299HCL | Recombinant Human WNT16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All WNT16 Products
Required fields are marked with *
My Review for All WNT16 Products
Required fields are marked with *
0
Inquiry Basket