Recombinant Human WNT16 protein, His-tagged
| Cat.No. : | WNT16-1477H |
| Product Overview : | Recombinant Human WNT16 protein(Q9UBV4)(191-330 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 191-330 aa |
| Form : | Phosphate buffered saline. |
| Molecular Mass : | 17kDa |
| AASequence : | TGKENKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFEKIGHLLKDKYENSIQISDKTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADGCNLLCCGRGYN |
| Storage : | Store at -20°C/-80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | WNT16 wingless-type MMTV integration site family, member 16 [ Homo sapiens ] |
| Official Symbol | WNT16 |
| Synonyms | WNT16; wingless-type MMTV integration site family, member 16; protein Wnt-16; wingless-type MMTV integration site family member 16b; |
| Gene ID | 51384 |
| mRNA Refseq | NM_016087 |
| Protein Refseq | NP_057171 |
| MIM | 606267 |
| UniProt ID | Q9UBV4 |
| ◆ Recombinant Proteins | ||
| WNT16-1477H | Recombinant Human WNT16 protein, His-tagged | +Inquiry |
| WNT16-1825HFL | Recombinant Full Length Human WNT16 Protein, C-Flag-tagged | +Inquiry |
| WNT16-243H | Recombinant Human WNT16, StrepII-tagged | +Inquiry |
| WNT16-5899H | Recombinant Human WNT16 Protein (Asn30-Lys365), N-GST tagged | +Inquiry |
| WNT16-583H | Active Recombinant Human WNT16 protein, His-GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| WNT16-299HCL | Recombinant Human WNT16 293 Cell Lysate | +Inquiry |
| WNT16-300HCL | Recombinant Human WNT16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All WNT16 Products
Required fields are marked with *
My Review for All WNT16 Products
Required fields are marked with *
Recently Viewed
