| Species : |
Human |
| Source : |
E.coli |
| Tag : |
GST |
| Protein Length : |
1-208 aa |
| Description : |
Binds glycerophospholipids in a barrel-like domain and may play a role in cellular lipid transport . Binds calcium (via the C2 domains) and translocates to sites of contact between the endoplasmic reticulum and the cell mbrane in response to increased cytosolic calcium levels. Helps tether the endoplasmic reticulum to the cell mbrane and promotes the formation of appositions between the endoplasmic reticulum and the cell mbrane. |
| Form : |
Tris-based buffer,50% glycerol |
| Molecular Mass : |
51.4 KD |
| AA Sequence : |
MERSPGEGPSPSPMDQPSAPSDPTDQPPAAHAKPDPGSGGQPAGPGAAGEALAVLTSFGRRLLVLIPVYLAGAVGLSVGFVLFGLALYLGWRRVRDEKERSLRAARQLLDDEEQLTAKTLYMSHRELPAWVSFPDVEKAEWLNKIVAQVWPFLGQYMEKLLAETVAPAVRGSNPHLQTFTFTRVELGEKPLRIIGVKVHPGQRKEQIL |
| Purity : |
> 90% as determined by SDS-PAGE. |
| Notes : |
Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : |
A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |