Recombinant MERS-CoV S Protein, His-tagged

Cat.No. : S-017M
Product Overview : Recombinant MERS-CoV Spike RBD, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : MERS-CoV
Source : Insect cells
Tag : His
Description : MERS-CoV, which causes the Middles East Respiratory Syndrome (MERS), belongs to a family of viruses known as coronaviruses. MERS-CoV was first identified in the Kingdom of Saudi Arabia in 2012, which is a single and positive stranded RNA virus. Dromedary camels are widely considered as the source of the transmission of MERS-CoV. The rate of human transmission among household contacts of MERS patients has been approximately 5 % based on serological analysis. MERS-CoV has four structural proteins, known as the S (spike), E (envelope), M (membrane), and N (nucleocapsid) proteins. The spike protein, responsible for allowing the virus to attach to and fuse with the membrane of a host cell and is a large type I transmembrane protein containing two subunits, S1 and S2. S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing the cell surface receptor. S2 contains basic elements needed for the membrane fusion. MERS-CoV S mediates viral attachment and fusion to human cells via human cellular receptor DPP4, also known as CD26. The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity. Recombinant MERS-CoV Spike RBD, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Form : Liquid
Molecular Mass : 28.2kDa
AA Sequence : SGVYSVSSFEAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEY
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -96 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Official Symbol S
Synonyms Middle East respiratory syndrome coronavirus; Human betacoronavirus 2c EMC/2012; MERS-CoV; MERS; MERSCoV RBD; MERS RBD; receptor binding domain; RBD; Spike RBD protein
UniProt ID K0BRG7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S Products

Required fields are marked with *

My Review for All S Products

Required fields are marked with *

0
cart-icon