Active Recombinant Mouse Ccl2 Protein (73 aa)
Cat.No. : | Ccl2-173C |
Product Overview : | Recombinant mouse MCP-1/CCL2 produced in HEK293 cells is a polypeptide chain containing 73 amino acids. A fully biologically active molecule, rmMCP-1/CCL2 has a molecular mass of 8 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Protein Length : | 73 |
Description : | Chemokine (C-C motif) ligand 2 (CCL2) is also referred to as monocyte chemotactic protein 1 (MCP1) and small inducible cytokine A2. CCL2 is a small cytokine that belongs to the CC chemokine family. CCL2 recruits monocytes, memory T cells, and dendritic cells to the sites of inflammation produced by either tissue injury or infection. CCL2 is implicated in the pathogeneses of several types of disease characterized by monocytic infiltrates, such as psoriasis, rheumatoid arthritis and atherosclerosis. CCL2 is anchored in the plasma membrane of endothelial cells by glycosaminoglycan side chains of proteoglycans. CCL2 is primarily secreted by monocytes, macrophages and dendritic cells. CCL2 can signal through the CCR2 receptor. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The EC50 value of mouse MCP-1/CCL2 on Ca^2+ mobilization assay in CHO-K1/Gα15/mCCR2 cells (human Gα15 and mouse CCR2 stably expressed in CHO-K1 cells) is less than 0.3 μg/mL. |
Molecular Mass : | 8 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMR |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 98% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Mouse MCP-1/CCL2 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse MCP-1/CCL2 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Ccl2 chemokine (C-C motif) ligand 2 [ Mus musculus ] |
Official Symbol | Ccl2 |
Synonyms | CCL2; chemokine (C-C motif) ligand 2; C-C motif chemokine 2; small inducible cytokine A2; small-inducible cytokine A2; monocyte chemotactic protein 1; monocyte chemoattractant protein 1; monocyte chemoattractant protein-1; platelet-derived growth factor-inducible protein JE; JE; HC11; MCAF; MCP1; MCP-1; Scya2; Sigje; SMC-CF; AI323594; |
Gene ID | 20296 |
mRNA Refseq | NM_011333 |
Protein Refseq | NP_035463 |
UniProt ID | P10148 |
◆ Recombinant Proteins | ||
CCL2-1679M | Active Recombinant Mouse CCL2, MIgG2a Fc-tagged | +Inquiry |
Ccl2-282M | Active Recombinant Mouse Chemokine (C-C motif) Ligand 2 | +Inquiry |
Ccl2-2031M | Recombinant Mouse Ccl2 Protein, Myc/DDK-tagged | +Inquiry |
Ccl2-685G | Recombinant Guinea pig Ccl2 protein, His & T7-tagged | +Inquiry |
CCL2-3792H | Recombinant Human CCL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL2-001MCL | Recombinant Mouse CCL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl2 Products
Required fields are marked with *
My Review for All Ccl2 Products
Required fields are marked with *
0
Inquiry Basket