Active Recombinant Mouse Ccl7 Protein (74 aa)
Cat.No. : | Ccl7-225C |
Product Overview : | Recombinant Mouse MCP-3/MARC/CCL7 produced in CHO cells is a polypeptide chain containing 74 amino acids. A fully biologically active molecule, rmMCP 3/CCL7 has a molecular mass of 8-12 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | CHO |
Protein Length : | 74 |
Description : | Chemokine (C-C motif) ligand 7 (CCL7) is a small cytokine that was previously called monocyte-specific chemokine 3 (MCP-3). Due to CCL7 possessing two adjacent N-terminal cysteine residues in its mature form, it is classified within the subfamily of chemokines known as CC chemokines. CCL7 specifically attracts monocytes, and regulates macrophage function. It is produced by certain tumor cell lines and by macrophages. This chemokine is located on chromosome 17 in humans, within a large cluster containing many other CC chemokines and is most closely related to CCL2. CCL7 can signal through the CCR1, CCR2 and CCR3 receptors. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The EC50 value of mouse MCP3 MARC/CCL7 on Ca^2+ mobilization assay in CHO-K1/Gα15/mCCR2 cells (human Gα15 and mouse CCR2 stably expressed in CHO-K1 cells) is less than 1 μg/mL. |
Molecular Mass : | 8~12 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 98% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant Mouse MCP-3/MARC/CCL7 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Mouse MCP-3/MARC/CCL7 should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Ccl7 chemokine (C-C motif) ligand 7 [ Mus musculus ] |
Official Symbol | Ccl7 |
Synonyms | CCL7; chemokine (C-C motif) ligand 7; C-C motif chemokine 7; RANTES/sis homolog; intercrine/chemokine MARC; small inducible cytokine A7; small-inducible cytokine A7; monocyte chemotactic protein 3; monocyte chemoattractant protein 3; fic; marc; mcp3; MCP-3; Scya7; |
Gene ID | 20306 |
mRNA Refseq | NM_013654 |
Protein Refseq | NP_038682 |
UniProt ID | Q03366 |
◆ Recombinant Proteins | ||
CCL7-132H | Active Recombinant Human CCL7, biotinylated | +Inquiry |
Ccl7-697R | Recombinant Rat Ccl7 protein, His & T7-tagged | +Inquiry |
CCL7-176H | Recombinant Human CCL7 Protein, Mature chain, Tag Free, Biotinylated | +Inquiry |
Ccl7-225C | Active Recombinant Mouse Ccl7 Protein (74 aa) | +Inquiry |
CCL7-2955HF | Recombinant Full Length Human CCL7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL7-170HCL | Recombinant Human CCL7 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ccl7 Products
Required fields are marked with *
My Review for All Ccl7 Products
Required fields are marked with *
0
Inquiry Basket