Recombinant Mouse FOLR1 Protein, His-tagged

Cat.No. : FOLR1-253M
Product Overview : Recombinant Mouse FOLR1 protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Protein Length : 255
Description : Predicted to enable carboxylic acid binding activity; folic acid receptor activity; and signaling receptor activity. Involved in circulatory system development; nervous system development; and regulation of signal transduction. Acts upstream of or within folic acid metabolic process. Predicted to be located in several cellular components, including apical plasma membrane; basolateral plasma membrane; and brush border membrane. Predicted to be anchored component of plasma membrane. Predicted to be anchored component of external side of plasma membrane. Is expressed in several structures, including brain; early conceptus; genitourinary system; gut; and retina. Human ortholog(s) of this gene implicated in cerebral folate receptor alpha deficiency. Orthologous to human FOLR1 (folate receptor alpha).
Form : Lyophilized
Molecular Mass : 26.2 kDa
AA Sequence : MAHLMTVQLLLLVMWMAECAQSRATRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGAGFHGTWPLLCSLSLVLLWVIS
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Folr1 folate receptor 1 (adult) [ Mus musculus (house mouse) ]
Official Symbol FOLR1
Synonyms FOLR1; folate receptor 1 (adult); folate receptor alpha; FR-alpha; folate binding protein 1; folate-binding protein 1; FBP1; Folbp1; Folbp-1;
Gene ID 14275
mRNA Refseq NM_001252552
Protein Refseq NP_001239481
UniProt ID P35846

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FOLR1 Products

Required fields are marked with *

My Review for All FOLR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon