Recombinant Mouse FOLR1 Protein, His-tagged
Cat.No. : | FOLR1-253M |
Product Overview : | Recombinant Mouse FOLR1 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | 255 |
Description : | Predicted to enable carboxylic acid binding activity; folic acid receptor activity; and signaling receptor activity. Involved in circulatory system development; nervous system development; and regulation of signal transduction. Acts upstream of or within folic acid metabolic process. Predicted to be located in several cellular components, including apical plasma membrane; basolateral plasma membrane; and brush border membrane. Predicted to be anchored component of plasma membrane. Predicted to be anchored component of external side of plasma membrane. Is expressed in several structures, including brain; early conceptus; genitourinary system; gut; and retina. Human ortholog(s) of this gene implicated in cerebral folate receptor alpha deficiency. Orthologous to human FOLR1 (folate receptor alpha). |
Form : | Lyophilized |
Molecular Mass : | 26.2 kDa |
AA Sequence : | MAHLMTVQLLLLVMWMAECAQSRATRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGAGFHGTWPLLCSLSLVLLWVIS |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Folr1 folate receptor 1 (adult) [ Mus musculus (house mouse) ] |
Official Symbol | FOLR1 |
Synonyms | FOLR1; folate receptor 1 (adult); folate receptor alpha; FR-alpha; folate binding protein 1; folate-binding protein 1; FBP1; Folbp1; Folbp-1; |
Gene ID | 14275 |
mRNA Refseq | NM_001252552 |
Protein Refseq | NP_001239481 |
UniProt ID | P35846 |
◆ Recombinant Proteins | ||
FOLR1-31H | Recombinant Human FOLR1 Protein, C-6His-Avi tagged, Biotinylated | +Inquiry |
FOLR1-1147R | Recombinant Rat FOLR1 Protein, His-tagged | +Inquiry |
FOLR1-1146RAF488 | Recombinant Rat FOLR1 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Folr1-0630M | Recombinant Mouse Folr1 protein, His-tagged, Biotinylated | +Inquiry |
FOLR1-1558R | Recombinant Rhesus Macaque FOLR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FOLR1-2113MCL | Recombinant Mouse FOLR1 cell lysate | +Inquiry |
FOLR1-2103HCL | Recombinant Human FOLR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FOLR1 Products
Required fields are marked with *
My Review for All FOLR1 Products
Required fields are marked with *
0
Inquiry Basket