Species : |
Mouse |
Source : |
HEK293 |
Tag : |
His |
Protein Length : |
255 |
Description : |
Predicted to enable carboxylic acid binding activity; folic acid receptor activity; and signaling receptor activity. Involved in circulatory system development; nervous system development; and regulation of signal transduction. Acts upstream of or within folic acid metabolic process. Predicted to be located in several cellular components, including apical plasma membrane; basolateral plasma membrane; and brush border membrane. Predicted to be anchored component of plasma membrane. Predicted to be anchored component of external side of plasma membrane. Is expressed in several structures, including brain; early conceptus; genitourinary system; gut; and retina. Human ortholog(s) of this gene implicated in cerebral folate receptor alpha deficiency. Orthologous to human FOLR1 (folate receptor alpha). |
Form : |
Lyophilized |
Molecular Mass : |
26.2 kDa |
AA Sequence : |
MAHLMTVQLLLLVMWMAECAQSRATRARTELLNVCMDAKHHKEKPGPEDNLHDQCSPWKTNSCCSTNTSQEAHKDISYLYRFNWNHCGTMTSECKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERILDVPLCKEDCQQWWEDCQSSFTCKSNWHKGWNWSSGHNECPVGASCHPFTFYFPTSAALCEEIWSHSYKLSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAEAMSGAGFHGTWPLLCSLSLVLLWVIS |
Purity : |
> 98% |
Applications : |
WB; ELISA; FACS; FC |
Stability : |
This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : |
At -20 centigrade. |
Concentration : |
1 mg/mL |
Storage Buffer : |
PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : |
Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |