Recombinant Mouse Gsta1 Protein, His-tagged
Cat.No. : | Gsta1-7218M |
Product Overview : | Recombinant mouse Gsta1, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-223 |
Description : | Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. |
Form : | Liquid |
Molecular Mass : | 28 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSMAGKPVLHYFNARGRMECIRWLLAAAGVEFEEKFIQSPEDLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPLLKAFKSRISSLPNVKKFLQPGSQRKPPMDAKQIQEARKAFKIQ |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by bradford assay) |
Storage Buffer : | In Phosphate buffered saline (pH7.4) containing 10 % glycerol, 1 mM DTT. |
Gene Name | Gsta1 glutathione S-transferase, alpha 1 (Ya) [ Mus musculus (house mouse) ] |
Official Symbol | Gsta1 |
Synonyms | Gsta1; glutathione S-transferase, alpha 1 (Ya); Gst2-; Gst2-1; glutathione S-transferase A1; 13-hydroperoxyoctadecadienoate peroxidase; GST class-alpha member 1; androst-5-ene-3,17-dione isomerase; glutathione S-transferase Ya; glutathione S-transferase Ya1; EC 2.5.1.18 |
Gene ID | 14857 |
mRNA Refseq | NM_008181 |
Protein Refseq | NP_032207 |
UniProt ID | P13745 |
◆ Recombinant Proteins | ||
GSTA1-2654H | Recombinant Human GSTA1 protein, His-tagged | +Inquiry |
GSTA1-104H | Active Recombinant Human GSTA1 Protein | +Inquiry |
Gsta1-7218M | Recombinant Mouse Gsta1 Protein, His-tagged | +Inquiry |
GSTA1-1986R | Recombinant Rhesus monkey GSTA1 Protein, His-tagged | +Inquiry |
GSTA1-489H | Recombinant Human Glutathione S-transferase Alpha 1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTA1-5719HCL | Recombinant Human GSTA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gsta1 Products
Required fields are marked with *
My Review for All Gsta1 Products
Required fields are marked with *