Active Recombinant Mouse IL17A Protein
Cat.No. : | IL17A-139M |
Product Overview : | Recombinant Mouse IL17A Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Interleukin 17A (IL-17A), also known as CTLA-8, is a member of the IL-17 family of proteins. |
Bio-activity : | Production of IL-6 by mouse 3T3 cells, ≤5 ng/mL |
AA Sequence : | MAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Gene Name | Il17a interleukin 17A [ Mus musculus (house mouse) ] |
Official Symbol | IL17A |
Synonyms | IL17A; interleukin 17A; interleukin-17A; cytotoxic T-lymphocyte-associated antigen 8; Il17; Ctla8; IL-17; Ctla-8; IL-17A; |
Gene ID | 16171 |
mRNA Refseq | NM_010552 |
Protein Refseq | NP_034682 |
UniProt ID | Q62386 |
◆ Recombinant Proteins | ||
IL17A-97H | Recombinant Human IL-17A | +Inquiry |
Il17a-489R | Recombinant Rat Il17a protein | +Inquiry |
Il17a-89R | Recombinant Rat Interleukin 17A | +Inquiry |
IL17A-98O | Recombinant Ovine IL-17A | +Inquiry |
Il17a-52M | Active Recombinant Mouse Il17a Protein (Ala26-Ala158), C-His tagged, Animal-free, Carrier-free | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL17A-001HCL | Recombinant Human IL17A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL17A Products
Required fields are marked with *
My Review for All IL17A Products
Required fields are marked with *
0
Inquiry Basket