Recombinant Mouse Lcn2 Protein, His-tagged
Cat.No. : | Lcn2-7249M |
Product Overview : | Recombinant mouse Lcn2 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-200 |
Description : | Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development. Binds iron through association with 2,3-dihydroxybenzoic acid (2,3-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity; limits bacterial proliferation by sequestering iron bound to microbial siderophores, such as enterobactin. Can also bind siderophores from M.tuberculosis. |
Form : | Liquid |
Molecular Mass : | 23.3 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSQDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFTMYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQFAMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN |
Purity : | > 85 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by bradford assay) |
Storage Buffer : | In Phosphate buffered saline (pH7.4) containing 10 % glycerol, 1 mM DTT. |
Gene Name | Lcn2 lipocalin 2 [ Mus musculus (house mouse) ] |
Official Symbol | Lcn2 |
Synonyms | Lcn2; lipocalin 2; N; 24p; NRL; 24p3; Sip24; AW212229; neutrophil gelatinase-associated lipocalin; SV-40-induced 24P3 protein; neu-related lipocalin; oncogene 24p3; p25; secreted inducible protein 24; siderocalin LCN2 |
Gene ID | 16819 |
mRNA Refseq | NM_008491 |
Protein Refseq | NP_032517 |
UniProt ID | P11672 |
◆ Recombinant Proteins | ||
LCN2-342H | Recombinant Human LCN2 Protein, MYC/DDK-tagged | +Inquiry |
LCN2-29121TH | Recombinant Human LCN2, His-tagged | +Inquiry |
LCN2-28594TH | Recombinant Human LCN2 protein | +Inquiry |
Lcn2-5710M | Recombinant Mouse Lcn2 Protein (Gln21-Asn200), C-Fc tagged | +Inquiry |
LCN2-4425H | Recombinant Human LCN2 Protein (Gln21-Gly198), N-His tagged | +Inquiry |
◆ Native Proteins | ||
LCN2-384H | Native Human LCN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCN2-538RCL | Recombinant Rat LCN2 cell lysate | +Inquiry |
LCN2-2781MCL | Recombinant Mouse LCN2 cell lysate | +Inquiry |
LCN2-2895HCL | Recombinant Human LCN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lcn2 Products
Required fields are marked with *
My Review for All Lcn2 Products
Required fields are marked with *
0
Inquiry Basket