Recombinant Mouse Lgals4 Protein, His-tagged
Cat.No. : | Lgals4-263M |
Product Overview : | Recombinant Mouse Lgals4 protein with His tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Protein Length : | 326 |
Description : | Enables galactoside binding activity. Located in extracellular space. Is expressed in several structures, including gonad; gut; heart; liver; and spleen. Orthologous to human LGALS4 (galectin 4). |
Form : | Lyophilized |
Molecular Mass : | 38.6 kDa |
AA Sequence : | MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | Lgals4 lectin, galactose binding, soluble 4 [ Mus musculus (house mouse) ] |
Official Symbol | Lgals4 |
Synonyms | LGALS4; lectin, galactose binding, soluble 4; galectin-4; lactose-binding lectin 4; gal-4; |
Gene ID | 16855 |
mRNA Refseq | NM_010706 |
Protein Refseq | NP_034836 |
UniProt ID | Q8K419 |
◆ Recombinant Proteins | ||
Lgals4-3168R | Recombinant Rat Lgals4 protein | +Inquiry |
Lgals4-7261M | Active Recombinant Mouse Lgals4 Protein, His-tagged | +Inquiry |
LGALS4-455H | Recombinant Human Lectin, Galactoside-Binding, Soluble, 4 | +Inquiry |
LGALS4-262H | Recombinant Human LGALS4 Protein, His-tagged | +Inquiry |
LGALS4-192H | Active Recombinant Human LGALS4 Protein (Ala2-Ile323), N-His tagged, Animal-free, Carrier-free | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lgals4 Products
Required fields are marked with *
My Review for All Lgals4 Products
Required fields are marked with *
0
Inquiry Basket