Recombinant Mouse Lgals4 Protein, His-tagged

Cat.No. : Lgals4-263M
Product Overview : Recombinant Mouse Lgals4 protein with His tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : HEK293
Tag : His
Protein Length : 326
Description : Enables galactoside binding activity. Located in extracellular space. Is expressed in several structures, including gonad; gut; heart; liver; and spleen. Orthologous to human LGALS4 (galectin 4).
Form : Lyophilized
Molecular Mass : 38.6 kDa
AA Sequence : MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSVYIQGMAKENMRRFHVNFAVGQDDGADVAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGKHFELVFMVMPEHYKVVVNGNSFYEYGHRLPVQMVTHLQVDGDLELQSINFLGGQPAAAPYPGAMTIPAYPAGSPGYNPPQMNTLPVMTGPPVFNPRVPYVGALQGGLTVRRTIIIKGYVLPTARNFVINFKVGSSGDIALHLNPRIGDSVVRNSFMNGSWGAEERKVAYNPFGPGQFFDLSIRCGMDRFKVFANGQHLFDFSHRFQAFQMVDTLEINGDITLSYVQI
Purity : > 98%
Applications : WB; ELISA; FACS; FC
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name Lgals4 lectin, galactose binding, soluble 4 [ Mus musculus (house mouse) ]
Official Symbol Lgals4
Synonyms LGALS4; lectin, galactose binding, soluble 4; galectin-4; lactose-binding lectin 4; gal-4;
Gene ID 16855
mRNA Refseq NM_010706
Protein Refseq NP_034836
UniProt ID Q8K419

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Lgals4 Products

Required fields are marked with *

My Review for All Lgals4 Products

Required fields are marked with *

0
cart-icon