Recombinant Mouse Mup1 Protein, His-tagged

Cat.No. : Mup1-7287M
Product Overview : Recombinant Mouse MUP1 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 19-180
Description : Restricted expression toward liver adult (RPKM 1970.0).
Form : Liquid
Molecular Mass : 21.1 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEKHGILRENIIDLSNANRCLQARE
Purity : > 95 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 1.0 mg/mL (determined by BCA assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 10 % Glycerol, 0.1 M NaCl
Gene Name Mup1 major urinary protein 1 [ Mus musculus (house mouse) ]
Official Symbol Mup1
Synonyms Mup1; major urinary protein 1; Ltn; Lvt; Mup; Up-; Mup-; Mup7; Up-1; Ltn-1; Mup-1; Mup-a; Mup10; Lvtn-1; major urinary protein 1; MUP 1; major urinary protein 10; major urinary protein 7
Gene ID 17840
mRNA Refseq NM_001163010
Protein Refseq NP_001156482
UniProt ID A2CEL1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Mup1 Products

Required fields are marked with *

My Review for All Mup1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon