Recombinant Mouse Mup1 Protein, His-tagged
Cat.No. : | Mup1-7287M |
Product Overview : | Recombinant Mouse MUP1 protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-180 |
Description : | Restricted expression toward liver adult (RPKM 1970.0). |
Form : | Liquid |
Molecular Mass : | 21.1 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSEEASSTGRNFNVEKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEKHGILRENIIDLSNANRCLQARE |
Purity : | > 95 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 1.0 mg/mL (determined by BCA assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 10 % Glycerol, 0.1 M NaCl |
Gene Name | Mup1 major urinary protein 1 [ Mus musculus (house mouse) ] |
Official Symbol | Mup1 |
Synonyms | Mup1; major urinary protein 1; Ltn; Lvt; Mup; Up-; Mup-; Mup7; Up-1; Ltn-1; Mup-1; Mup-a; Mup10; Lvtn-1; major urinary protein 1; MUP 1; major urinary protein 10; major urinary protein 7 |
Gene ID | 17840 |
mRNA Refseq | NM_001163010 |
Protein Refseq | NP_001156482 |
UniProt ID | A2CEL1 |
◆ Recombinant Proteins | ||
Mup1-7287M | Recombinant Mouse Mup1 Protein, His-tagged | +Inquiry |
MUP1-545M | Recombinant Mouse major urinary protein 1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mup1 Products
Required fields are marked with *
My Review for All Mup1 Products
Required fields are marked with *