Recombinant Mouse REG3G Protein (27-174 aa), His-tagged
Cat.No. : | REG3G-1502M |
Product Overview : | Recombinant Mouse REG3G Protein (27-174 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | Yeast |
Tag : | His |
Protein Length : | 27-174 aa |
Description : | Bactericidal C-type lectin which acts exclusively against Gram-positive bacteria and mediates bacterial killing by binding to surface-exposed carbohydrate moieties of peptidoglycan. Restricts bacterial colonization of the intestinal epithelial surface and consequently limits activation of adaptive immune responses by the microbiota. The uncleaved form has bacteriostatic activity, whereas the cleaved form has bactericidal activity against L.monocytogenes and methicillin-resistant S.aureus. Regulates keratinocyte proliferation and differentiation after skin injury. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 18.3 kDa |
AA Sequence : | EVAKKDAPSSRSSCPKGSRAYGSYCYALFSVSKNWYDADMACQKRPSGHLVSVLSGAEASFLSSMIKSSGNSGQYVWIGLHDPTLGYEPNRGGWEWSNADVMNYINWETNPSSSSGNHCGTLSRASGFLKWRENYCNLELPYVCKFKA |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | Reg3g regenerating islet-derived 3 gamma [ Mus musculus ] |
Official Symbol | REG3G |
Synonyms | REG3G; REG-3-gamma; reg III-gamma; RegIII (gamma); AI449515; |
Gene ID | 19695 |
mRNA Refseq | NM_011260 |
Protein Refseq | NP_035390 |
UniProt ID | O09049 |
◆ Recombinant Proteins | ||
REG3G-5633H | Recombinant Human REG3G Protein (Glu27-Asp175), C-His tagged | +Inquiry |
REG3G-1202H | Recombinant Human REG3G protein(27-175aa), GST-tagged | +Inquiry |
Reg3g-1283M | Recombinant Mouse Reg3g protein, His & S-tagged | +Inquiry |
REG3G-1282H | Recombinant Human REG3G protein, His & T7-tagged | +Inquiry |
REG3G-4649R | Recombinant Rat REG3G Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
REG3G-2438HCL | Recombinant Human REG3G cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REG3G Products
Required fields are marked with *
My Review for All REG3G Products
Required fields are marked with *
0
Inquiry Basket