Recombinant Human REG3G protein(27-175aa), GST-tagged
| Cat.No. : | REG3G-1202H |
| Product Overview : | Recombinant Human REG3G protein(Q6UW15)(27-175aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 27-175aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 44.0 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | EETQKELPSPRISCPKGSKAYGSPCYALFLSPKSWMDADLACQKRPSGKLVSVLSGAEGSFVSSLVRSISNSYSYIWIGLHDPTQGSEPDGDGWEWSSTDVMNYFAWEKNPSTILNPGHCGSLSRSTGFLKWKDYNCDAKLPYVCKFKD |
| Gene Name | REG3G regenerating islet-derived 3 gamma [ Homo sapiens ] |
| Official Symbol | REG3G |
| Synonyms | REG3G; regenerating islet-derived 3 gamma; regenerating islet-derived protein 3-gamma; LPPM429; PAP1B; UNQ429; PAP-1B; REG-3-gamma; reg III-gamma; regenerating gene III; pancreatitis-associated protein 1B; pancreatitis-associated protein IB; regenerating islet-derived protein III-gamma; PAPIB; PAP IB; REG-III; MGC118998; MGC118999; MGC119001; |
| Gene ID | 130120 |
| mRNA Refseq | NM_001008387 |
| Protein Refseq | NP_001008388 |
| MIM | 609933 |
| UniProt ID | Q6UW15 |
| ◆ Recombinant Proteins | ||
| Reg3g-1283M | Recombinant Mouse Reg3g protein, His & S-tagged | +Inquiry |
| REG3G-1202H | Recombinant Human REG3G protein(27-175aa), GST-tagged | +Inquiry |
| Reg3g-3420R | Recombinant Rat Reg3g protein, His-tagged | +Inquiry |
| Reg3g-5455M | Recombinant Mouse Reg3g Protein, Myc/DDK-tagged | +Inquiry |
| REG3G-804H | Recombinant Human REG3G Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| REG3G-2438HCL | Recombinant Human REG3G cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All REG3G Products
Required fields are marked with *
My Review for All REG3G Products
Required fields are marked with *
