Recombinant Mouse SIAE Protein, his-tagged
Cat.No. : | SIAE-110M |
Product Overview : | Recombinant Mouse SIAE Protein, fused to His-tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | HEK293 |
Tag : | His |
Description : | Predicted to enable sialate O-acetylesterase activity. Predicted to be involved in carbohydrate metabolic process and regulation of immune system process. Located in lysosome. Is expressed in several structures, including abdominal fat pad; central nervous system; dorsal aorta; genitourinary system; and yolk sac. Human ortholog(s) of this gene implicated in autoimmune disease. Orthologous to human SIAE (sialic acid acetylesterase). |
Form : | PBS, pH 7.4. |
Molecular Mass : | 59.7 kDa |
AA Sequence : | AGIGFRFASYIDNYMVLQKEPSGAVIWGFGTPGATVTVTLCQGQETIMKKVTSVKEPSNTWMVVLDPMKPGGPFEVMAQQTLGTMNFTLRVHDVLFGDVWLCSGQSNMQMTVSQIFNASKELSDTAAYQSVRIFSVSLIQSEEELDDLTEVDLSWSKPTAGNLGHGNFTYMSAVCWLFGRYLYDTLQYPIGLVSSSWGGTYIEVWSSRRTLKACGVPNTRDERVGQPEIKPMRNECNSEESSCPFRVVPSVRVTGPTRHSVLWNAMIHPLQNMTLKGVVWYQGESNADYNRDLYTCMFPELIEDWRQTFHYGSQGQTDRFFPFGFVQLSSYMLKNSSDYGFPEIRWHQTADFGHVPNPKMPNTFMAVAIDLCDRDSPFGSIHPRDKQTVAYRLHLGARAVAYGEKNLTFQGPLPKKIELLASNGLLNLTYDQEIQVQMQDNKTFEISCCSDRHCKWLPAPVNTFSTQTLILDLNACLGTVVAVRYAWTTWPCEYKQCAVYHTSSMLPAPPFIAQISHRGIHHHHHHHH |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 1.6 mg/ml |
Gene Name | Siae sialic acid acetylesterase [ Mus musculus (house mouse) ] |
Official Symbol | SIAE |
Synonyms | LSE; Ysg2 |
Gene ID | 22619 |
mRNA Refseq | NM_011734 |
Protein Refseq | NP_035864 |
UniProt ID | P70665 |
◆ Recombinant Proteins | ||
SIAE-15119M | Recombinant Full Length Mouse SIAE Protein, His tagged | +Inquiry |
SIAE-189H | Recombinant Human SIAE protein, His-tagged | +Inquiry |
SIAE-3872Z | Recombinant Zebrafish SIAE | +Inquiry |
SIAE-10HFL | Active Recombinant Full Length Human sialic acid acetylesterase protein, His tagged | +Inquiry |
SIAE-5930H | Recombinant Human SIAE Protein (Ile24-Lys523), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIAE-001HCL | Recombinant Human SIAE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIAE Products
Required fields are marked with *
My Review for All SIAE Products
Required fields are marked with *
0
Inquiry Basket