Recombinant Mouse SLAMF7 Protein (23-224 aa), His-tagged
Cat.No. : | SLAMF7-2323M |
Product Overview : | Recombinant Mouse SLAMF7 Protein (23-224 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 23-224 aa |
Description : | Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Mediates natural killer (NK) cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on the adapter SH2D1B. In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function. Acts also inhibitory in T-cells. May play a role in lymphocyte adhesion. In LPS-activated monocytes negatively regulates production of proinflammatory cytokines. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 27.8 kDa |
AA Sequence : | SGTLKKVAGALDGSVTFTLNITEIKVDYVVWTFNTFFLAMVKKDGVTSQSSNKERIVFPDGLYSMKLSQLKKNDSGAYRAEIYSTSSQASLIQEYVLHVYKHLSRPKVTIDRQSNKNGTCVINLTCSTDQDGENVTYSWKAVGQGDNQFHDGATLSIAWRSGEKDQALTCMARNPVSNSFSTPVFPQKLCEDAATDLTSLRG |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | Slamf7 SLAM family member 7 [ Mus musculus ] |
Official Symbol | SLAMF7 |
Synonyms | SLAMF7; SLAM family member 7; novel Ly9; leukocyte cell-surface antigen; 19A; CS1; 19A24; CRACC; 4930560D03Rik; |
Gene ID | 75345 |
mRNA Refseq | NM_144539 |
Protein Refseq | NP_653122 |
UniProt ID | Q8BHK6 |
◆ Recombinant Proteins | ||
SLAMF7-186HAF647 | Recombinant Human SLAMF7 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
SLAMF7-352M | Recombinant Mouse SLAMF7 protein, Mouse IgG2a Fc-tagged, low endotoxin | +Inquiry |
SLAMF7-2688H | Active Recombinant Human SLAMF7 protein, hFc&His-tagged | +Inquiry |
SLAMF7-107H | Recombinant Human SLAMF7 protein, His-Avi-tagged | +Inquiry |
SLAMF7-1424H | Recombinant Human SLAMF7 Protein (Ser23-His175), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLAMF7-2591MCL | Recombinant Mouse SLAMF7 cell lysate | +Inquiry |
SLAMF7-2378HCL | Recombinant Human SLAMF7 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLAMF7 Products
Required fields are marked with *
My Review for All SLAMF7 Products
Required fields are marked with *
0
Inquiry Basket