Recombinant Pan-species (General) EXT Protein, His-tagged, BSA Conjugated

• Cat.No.: EXT-2774P
• Product Overview: Recombinant Pan-species (General) EXT Protein fused with a N-His tag.

Specification

• Species: Pan-species
• Tag: His
• Description: Exenatide is an injectable drug that reduces the level of sugar (glucose) in the blood.
• Form: Freeze-dried powder
• AA Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
• Purity: > 90%
• Stability: The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
• Storage: Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
• Storage Buffer: PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
• Reconstitution: Reconstitute in PBS or others.

Gene Information

• Official Symbol: EXT
• Synonyms: Exenatide; EXT; Byetta; Bydureon; Exendin-4