Active Recombinant Porcine IL4 Protein
Cat.No. : | IL4-180P |
Product Overview : | Recombinant Porcine IL4 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine |
Source : | E.coli |
Description : | Interleukin 4 (IL-4) is an immunomodulatory cytokine that functions to induce naïve helper T cells to differentiate into type 2 T helper (Th2) cells. Th2 cells subsequently produce more IL-4 in a positive feedback loop. IL-4 also promotes immunoglobulin IgG to IgE isotype switching on B cells. IL-4 binds the IL-4Rα receptor to activate STAT6 signaling. |
Bio-activity : | TF-1 cell proliferation, ED50≤2 ng/mL |
Molecular Mass : | Monomer, 12.7 kDa (with 110 amino acids) |
AA Sequence : | MHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL (50% confidence) |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | IL4 interleukin 4 [ Sus scrofa (pig) ] |
Official Symbol | IL4 |
Synonyms | IL4; interleukin 4; interleukin-4; IL-4; BSF-1; B-cell stimulatory factor 1; lymphocyte stimulatory factor 1; |
Gene ID | 397225 |
mRNA Refseq | NM_214123 |
Protein Refseq | NP_999288 |
UniProt ID | Q04745 |
◆ Recombinant Proteins | ||
IL4-1177H | Recombinant Human IL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL4-3105H | Recombinant Human IL4 protein, His-SUMO-tagged | +Inquiry |
IL4-250C | Recombinant Chicken Interleukin 4 | +Inquiry |
IL4-138H | Active Recombinant Human IL4, His tagged | +Inquiry |
il4-22Z | Recombinant Zebrafish il4 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL4-001MCL | Recombinant Mouse IL4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL4 Products
Required fields are marked with *
My Review for All IL4 Products
Required fields are marked with *
0
Inquiry Basket