Active Recombinant Rat Il12 Protein, His-tagged
Cat.No. : | Il12-258I |
Product Overview : | Recombinant Rat Il12 Protein with a His tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | CHO |
Tag : | His |
Description : | Interleukin-12 (IL-12), also known as NKSF, TCMF, CLMF and TSF, is a heterodimeric cytokine composed of p35 and p40 subunits. It is produced by monocytes, macrophages, B cells and dendritic cells in response to bacterial lipopolysaccharides and intracellular pathogens. IL-12 signals through the IL-12 receptor complex, which is comprised of IL-12 Rβ1 and IL-12 Rβ2. IL-12 induces the proliferation and activation of hematopoietic stem cells, natural killer cells and T- cells. It is indispensible during the development of Th1 cells, leading to the production of IFN-gamma and IL-2. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50< 0.1 ng/mL, measured in a cell proliferation assay using 2D6 cells. |
Molecular Mass : | 26-28kDa (p35) and 42-45 kDa (p40), observed by reducing SDS-PAGE. |
AA Sequence : | p35:RVIPVSGPAKCLNQSQNLLKTTDDMVRTAREKLKHYSCTAGDIDHEDITRDKTSTLEACLPLELHKNESCLATKETSSIIRGSCLPPQKTSLMMTLCLGSIYEDLKMYQSEFQAINAALQSHNHQQITLDRNMLMAIDELMRSLNHSGETLHQKAPMGEADPYRVKMKLCILLHAFSTRVMTINRVMNYLSSSHHHHHH p40:MWELEKDVYVVEVDWRPDAPGETVTLTCDSPEEDDITWTSDQRRGVIGSGKTLTITVREFLDAGQYTCHRGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVHRNTDLKFNIKSSSSSPESRAVTCGRASLSAEKVTLNQRDYEKYSVACQEDVTCPTAEETLPIELVVEAQQQNKYENYSTSFFIRDIIKPDPPKNLQVKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKTKETEEECNQKGAFLVEKTSAEVQCKGANICVQAQDRYYNSSCSKWTCVPCRGRS |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant rat Interleukin-12 (IL-12), His remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rat Interleukin-12 (IL-12), His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Il12 Interleukin 12 [ Rattus norvegicus ] |
Official Symbol | Il12 |
Synonyms | IL12; Interleukin 12; |
Gene ID | 64546 |
mRNA Refseq | NM_022611 |
Protein Refseq | NP_072133 |
UniProt ID | E9PU71 |
◆ Recombinant Proteins | ||
IL12-002M | Active Recombinant Mouse IL12, HIgG1 Fc-tagged | +Inquiry |
IL12-249H | Recombinant Human interleukin 12 Protein, His tagged | +Inquiry |
IL12-0097H | Recombinant Human IL12 Protein | +Inquiry |
IL12-159HB | Recombinant Human IL12 protein, His-tagged, Biotinylated | +Inquiry |
Il12b-175M | Active Recombinant Mouse interleukin 12 Protein, Flag tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Il12 Products
Required fields are marked with *
My Review for All Il12 Products
Required fields are marked with *
0
Inquiry Basket