"GST" Related Products

Expand

Recombinant S. japonicum GST Protein

Cat.No. : GST-001S
Product Overview : Recombinant Schistosoma japonicum GST was expressed in E.coli and purified by conventional chromatography techniques.
Description : GST, also known as, Glutathione S-transferase, represents a major group of detoxification enzymes. GST acts by catalyzing the reaction of glutathione with an acceptor molecule to form an S-substituted glutathione (S=sulfur). The reactions utilizing glutathione contribute the transformation of a wide range of compounds, including carcinogens, therapeutic drugs, and products of oxidative stress. As well as its enzymatic activities, GST may also bind toxins and function as transport protein. Because of this, an early term for GSTs was ligandin. GST was originally separated from Schistosomajaponicum but currently isolated from recombinant E.coli source.
Source : E.coli
Species : S. japonicum
Form : Liquid
Molecular Mass : 25.4 kDa
AASequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
Endotoxin : < 1 EU per 1μg of protein (determined by LAL method)
Purity : > 90% by SDS - PAGE
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1.0 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : In Phosphate Buffer Saline containing 10% glycerol
Warning : For research use only. This product is not intended or approved for human, diagnostics or veterin

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.