Recombinant Schistosoma japonicum GST Protein

Cat.No. : GST-8543S
Product Overview : Recombinant Schistosoma japonicum GST protein without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Schistosoma japonicum
Source : E.coli
Description : GST (Glutathione S-Transferase) is a 26kDa protein encoded by the parasitic helminth Schistosoma japonicum and widely used in the pGEX family of GST plasmid expression vectors as a fusion protein with foreign proteins.
Molecular Mass : ~25.5 kDa, reducing conditions
AA Sequence : MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
Purity : >90%, by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 6.1 mg/ml
Storage Buffer : Supplied as a 0.2 μm filtered solution in PBS, pH 8.0
Synonyms GST; Glutathione S Transferase; Glutathione S-transferase class-mu 26 kDa isozyme; Sj26 antigen; SjGST

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GST Products

Required fields are marked with *

My Review for All GST Products

Required fields are marked with *

0
cart-icon