Recombinant Schistosoma japonicum GST Protein

• Cat.No.: GST-8543S
• Product Overview: Recombinant Schistosoma japonicum GST protein without tag was expressed in E.coli.

Specification

• Species: Schistosoma japonicum
• Source: E.coli
• Description: GST (Glutathione S-Transferase) is a 26kDa protein encoded by the parasitic helminth Schistosoma japonicum and widely used in the pGEX family of GST plasmid expression vectors as a fusion protein with foreign proteins.
• Molecular Mass: ~25.5 kDa, reducing conditions
• AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPK
• Purity: >90%, by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Concentration: 6.1 mg/ml
• Storage Buffer: Supplied as a 0.2 μm filtered solution in PBS, pH 8.0

Gene Information

• Synonyms: GST; Glutathione S Transferase; Glutathione S-transferase class-mu 26 kDa isozyme; Sj26 antigen; SjGST