GFP

  • Official Full Name

    Green Fluorescent Protein
  • Overview

    Green fluorescence protein (GFP) is a 27 kDa protein derived from the jellyfish Aequorea victoria, which emits green light (emission peak at a wavelenth of 509 nm) when excited by blue light (excitation peak at a wavelenth of 395 nm). GFP has become an invaluable tool in cell biology research, since its intrinsic fluorescence can be visualized in living cells. GFP fluorescence is stable under fixation conditions and suitable for a variety of applications. GFP has been widely used as a reporter for gene expression, enabling researchers to visualize and localize GFP-tagged proteins within living cells without the need for chemical staining. Other applications of GFP include assessment of protein protein interactions through the yeast two hybrid system and measurement of distance between proteins through fluorescence energy transfer (FRET) protocols. GFP technnology has considerably contributed to a greater understanding of cellular physiology. YFP differs from GFP due to a mutation at T203Y; antibodies raised against full-length GFP should also detect YFP and other variants.
  • Synonyms

    GFP;Green Fluorescent Protein

Recombinant Proteins

  • Human
  • Renilla reniformis
  • Aequorea victoria
  • Jellyfish Aequorea Victoria
  • Bacterial
  • Pan-species
  • Bovine
  • Jellyfish
  • E.coli
  • P.pastoris
  • S.Cerevisiae
  • bovine Spinal Cord
  • Yeast
  • Mammalian Cells
  • His
  • Avi
  • Non
  • Flag
  • GST
  • HA
  • Myc
  • SUMO
Cat.# Product name Source (Host) Species Tag Protein Length Price
GFP-01 Recombinant GFP Protein E.coli
GFP-02 Recombinant GFP Protein E.coli
GFP-27H Active Recombinant EGFP-rProtein A, His-tagged E.coli His
GFP-430 Active Recombinant Human GFP/SNAP25B/VAMP-2 protein, His-tagged E.coli Human His 2-238;93-206;2-94 a.a.
GFP-01A GFP CoIP Agarose
GFP-02A GFP Magnetic CoIP Agarose
GFP-04A GFP Magnetic CoIP Agarose kit
GFP-23RB Recombinant Renilla reniformis GFP Protein, C-Avi tagged E.coli Renilla reniformis Avi
GFP-03A Active Recombinant Aequorea victoria GFP protein, His-tagged E.coli Aequorea victoria His Ser2-Lys238
GFP-11 Recombinant GFP Protein E.coli Aequorea victoria His 238 amino acids
GFP-1031A Recombinant Aequorea victoria GFP protein(Met1-Leu238), His-tagged E.coli Aequorea victoria His Met1-Leu238
GFP-83H Recombinant GFP protein, Arginine/His-tagged E.coli Jellyfish Aequorea Victoria His
GFP-05 Recombinant Green Fluorescent Protein, His tagged, Protein G Labeled E.coli His
GFP-1167A Recombinant Aequorea victoria GFP Protein (Met1-Lys239), C-His tagged E.coli Aequorea victoria His Met1-Lys239
GFP-11A Recombinant Aequorea victoria GFP Protein E.coli Aequorea victoria Non 1-238 aa
GFP-12 Recombinant Bacteria GFP Protein E.coli Bacterial His
GFP-159 Recombinant Green Fluorescent Protein P.pastoris Non 237 aa
GFP-160 Recombinant Green Fluorescent Protein S.Cerevisiae Non 237 aa
GFP-161 Recombinant Green Fluorescent Protein E.coli Non 234 aa
GFP-162 Recombinant Green Fluorescent Protein E.coli Non 222 aa
GFP-189 Recombinant Green Fluorescent Protein E.coli Non 237 aa
GFP-2220 Recombinant PolyTag-GFP Protein Flag&GST&HA&His&Myc
GFP-2760P Recombinant Pan-species (General) GFP Protein, His-tagged E.coli Pan-species His S-Met1-Lys238myc-FLAG tag
GFP-2761P Recombinant Pan-species (General) GFP Protein, His-tagged E.coli Pan-species His
GFP-301136 Recombinant GFP protein, GST-tagged E.coli GST Met1-Lys239
GFP-36B Native Bovine GFP bovine Spinal Cord Bovine Non
GFP-4012J Recombinant Jellyfish GFP protein, His-SUMO-tagged E.coli Jellyfish His&SUMO 1-238aa
GFP-5647J Recombinant Jellyfish GFP protein, His-tagged Yeast Jellyfish His 1-238aa
GFP-7050FL Recombinant Full Length GFP, Flag-tagged Mammalian Cells Flag Full L.
Kit-0364 GFP Quantitation Kit Non

    Involved Pathway

    GFP involved in several pathways and played different roles in them. We selected most pathways GFP participated on our site, such as , which may be useful for your reference. Also, other proteins which involved in the same pathway with GFP were listed below. Creative BioMart supplied nearly all the proteins listed, you can search them on our site.

    Pathway Name Pathway Related Protein

    Protein Function

    GFP has several biochemical functions, for example, . Some of the functions are cooperated with other proteins, some of the functions could acted by GFP itself. We selected most functions GFP had, and list some proteins which have the same functions with GFP. You can find most of the proteins on our site.

    Function Related Protein

    Interacting Protein

    GFP has direct interactions with proteins and molecules. Those interactions were detected by several methods such as yeast two hybrid, co-IP, pull-down and so on. We selected proteins and molecules interacted with GFP here. Most of them are supplied by our site. Hope this information will be useful for your research of GFP.

    Resources

    References

    • Rafiee, MR; Shafaroudi, AM; et al. Enrichment of A Rare Subpopulation of miR-302-Expressing Glioma Cells by Serum Deprivation. CELL JOURNAL 16:494-505(2015).
    • Jiang, JM; Lin, YX; et al. Proteomics approach reveals mechanism underlying susceptibility of loquat fruit to sunburn during color changing period. FOOD CHEMISTRY 176:388-395(2015).

    Ask a Question for All GFP Products

    Required fields are marked with *

    My Review for All GFP Products

    Required fields are marked with *