Recombinant GFP protein, GST-tagged
Cat.No. : | GFP-301136 |
Product Overview : | Recombinant GFP (1-239 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Lys239 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | green fluorescent protein mutant 3 [synthetic construct] |
Official Symbol | GFP |
Protein Refseq | 1669868 |
◆ Recombinant Proteins | ||
GFP-2760P | Recombinant Pan-species (General) GFP Protein, His-tagged | +Inquiry |
GFP-1167A | Recombinant Aequorea victoria GFP Protein (Met1-Lys239), C-His tagged | +Inquiry |
GFP-23RB | Recombinant Renilla reniformis GFP Protein, C-Avi tagged | +Inquiry |
GFP-27H | Active Recombinant EGFP-rProtein A, His-tagged | +Inquiry |
GFP-7050FL | Recombinant Full Length GFP, Flag-tagged | +Inquiry |
◆ Native Proteins | ||
GFP-36B | Native Bovine GFP | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFP Products
Required fields are marked with *
My Review for All GFP Products
Required fields are marked with *
0
Inquiry Basket