Recombinant Pan-species (General) GFP Protein, His-tagged
Cat.No. : | GFP-2760P |
Product Overview : | Recombinant Pan-species (General) GFP Protein (S-Met1-Lys238myc-FLAG tag) with a N-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pan-species |
Source : | E.coli |
Tag : | His |
Protein Length : | S-Met1-Lys238myc-FLAG tag |
Description : | Green Fluorescent Protein (GFP) is a versatile biological marker for monitoring physiological processes, visualizing protein localization, and detecting transgenic expression in vivo. |
Form : | Freeze-dried powder |
Molecular Mass : | Predicted Molecular Mass: 34.3 kDa Accurate Molecular Mass: 37 kDa |
Purity : | > 90% |
Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months. |
Storage Buffer : | 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300. |
Reconstitution : | Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
Official Symbol | GFP |
Synonyms | Green Fluorescent Protein; GFP |
◆ Recombinant Proteins | ||
GFP-1031A | Recombinant Aequorea victoria GFP protein(Met1-Leu238), His-tagged | +Inquiry |
GFP-2760P | Recombinant Pan-species (General) GFP Protein, His-tagged | +Inquiry |
GFP-301136 | Recombinant GFP protein, GST-tagged | +Inquiry |
GFP-430 | Active Recombinant Human GFP/SNAP25B/VAMP-2 protein, His-tagged | +Inquiry |
GFP-23RB | Recombinant Renilla reniformis GFP Protein, C-Avi tagged | +Inquiry |
◆ Native Proteins | ||
GFP-36B | Native Bovine GFP | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GFP Products
Required fields are marked with *
My Review for All GFP Products
Required fields are marked with *
0
Inquiry Basket