Recombinant GFP protein, Arginine/His-tagged
Cat.No. : | GFP-83H |
Product Overview : | Recombinant Enhanced GFP fused with 9 arginine domain / His Tag at C-terminal was expressed in E. coli. Incubating this protein in various culture mediums at 2ug/ ml concentration could be used for monitoring intracellular protein delivery efficiency. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Jellyfish Aequorea Victoria |
Source : | E.coli |
Tag : | His |
Form : | 1.0 mg/ml, sterile-filtered, in PBS buffer. |
AA Sequence : | MGDIMGEWGNEIFGAIAGFLGVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLP VPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGID FKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQ SALSKDPNEKRDHMVLLEFVTAAGITLGMDELYKSRHRRHRQRSRSRAAARRRRRRRRR |
Purity : | >95% by SDS-PAGE |
Applications : | 9 arginine tag modified GFP protein, which can be used as negative control in any transcription factor protein delivery experiments. |
Storage : | Keep at -20centigrade for long term storage. Product is stable at 4 centigrade for 30 days. |
◆ Recombinant Proteins | ||
GFP-2760P | Recombinant Pan-species (General) GFP Protein, His-tagged | +Inquiry |
GFP-430 | Active Recombinant Human GFP/SNAP25B/VAMP-2 protein, His-tagged | +Inquiry |
GFP-7050FL | Recombinant Full Length GFP, Flag-tagged | +Inquiry |
GFP-03A | Active Recombinant Aequorea victoria GFP protein, His-tagged | +Inquiry |
GFP-83H | Recombinant GFP protein, Arginine/His-tagged | +Inquiry |
◆ Native Proteins | ||
GFP-36B | Native Bovine GFP | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFP Products
Required fields are marked with *
My Review for All GFP Products
Required fields are marked with *