Recombinant GFP Protein
| Cat.No. : | GFP-01 |
| Product Overview : | Recombinant GFP Protein was expressed in E. coli. |
| Availability | November 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Description : | Protein NARROW LEAF 1 |
| Form : | Supplied as a 0.2 μm filtered solution in 10 mM PBS (pH 7.4). |
| AA Sequence : | KETWWETWWTEWSQPKKKRKGMSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYKTRTRPLEQKLISEEDLAANDIL DYKDDDDKV |
| Endotoxin : | <1.0 EU per ug (determined by the LAL method) |
| Purity : | >95% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Concentration : | 0.1 mg/ml |
| Gene Name | NAL1 Protein NARROW LEAF 1 [ Oryza sativa Japonica Group (Japanese rice) ] |
| Official Symbol | GFP |
| Synonyms | GFP; SPIKE; qFLW4; LSCHL4; OsJ_16147 |
| Gene ID | 4336986 |
| mRNA Refseq | NM_001419864.1 |
| Protein Refseq | NP_001406793.1 |
| UniProt ID | P42212 |
| ◆ Native Proteins | ||
| GFP-36B | Native Bovine GFP | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GFP Products
Required fields are marked with *
My Review for All GFP Products
Required fields are marked with *
