Synthetic human decarboxylated osteocalcin
| Cat.No. : | Osteocalcin-189H |
| Product Overview : | (Glu¹⁷·²¹·²⁴)-Osteocalcin (1-49) (human) trifluoroacetate salt H-Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Glu-Pro-Arg-Arg-Glu-Val-Cys-Glu-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val-OH trifluoroacetate salt (Disulfide bond) |
| Availability | August 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Tag : | Non |
| Protein Length : | 1-49 aa |
| Description : | The peptide hormone osteocalcin is involved not only in bone formation, it also plays an important role in glucose metabolism and could regulate testosteron. In mice, only the completely decarboxylated form of the peptide shows the latter hormonal activities, whereas in humans, osteocalcin, partially decarboxylated osteocalcins, and the uncarboxylated peptide seem to be involved. Generally, obese individuals have been shown to have lower osteocalcin(s) levels than non-obese controls, and type 2 diabetic individuals have lower plasma osteocalcin than non-diabetic individuals |
| Form : | White powder |
| Molecular Mass : | 5797.49 |
| AA Sequence : | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV |
| Purity : | 95.4% |
| Storage : | Store at -20 ± 5 centigrade. |
| Reconstitution : | Soluble in DMF at 1 mg/ml |
| Publications : |
| ◆ Recombinant Proteins | ||
| Osteocalcin-189H | Synthetic human decarboxylated osteocalcin | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Osteocalcin Products
Required fields are marked with *
My Review for All Osteocalcin Products
Required fields are marked with *



