Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Synthetic human decarboxylated osteocalcin

Cat.No. : Osteocalcin-189H
Product Overview : (Glu¹⁷·²¹·²⁴)-Osteocalcin (1-49) (human) trifluoroacetate salt
H-Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Glu-Pro-Arg-Arg-Glu-Val-Cys-Glu-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val-OH trifluoroacetate salt (Disulfide bond)
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
Description : The peptide hormone osteocalcin is involved not only in bone formation, it also plays an important role in glucose metabolism and could regulate testosteron. In mice, only the completely decarboxylated form of the peptide shows the latter hormonal activities, whereas in humans, osteocalcin, partially decarboxylated osteocalcins, and the uncarboxylated peptide seem to be involved. Generally, obese individuals have been shown to have lower osteocalcin(s) levels than non-obese controls, and type 2 diabetic individuals have lower plasma osteocalcin than non-diabetic individuals
Species : Human
Form : White powder
Molecular Mass : 5797.49
Protein length : 1-49 aa
AA Sequence : YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
Purity : 95.4%
Storage : Store at -20 ± 5 centigrade.
Reconstitution : Soluble in DMF at 1 mg/ml
Publication :
Osteocalcin and Non-Alcoholic Fatty Liver Disease: Lessons From Two Population-Based Cohorts and Animal Models (2020)
Decarboxylated osteocalcin, a possible drug for type 2 diabetes, triggers glucose uptake in MG63 cells (2021)

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends