Synthetic human decarboxylated osteocalcin
Cat.No. : | Osteocalcin-189H |
Product Overview : | (Glu¹⁷·²¹·²⁴)-Osteocalcin (1-49) (human) trifluoroacetate salt H-Tyr-Leu-Tyr-Gln-Trp-Leu-Gly-Ala-Pro-Val-Pro-Tyr-Pro-Asp-Pro-Leu-Glu-Pro-Arg-Arg-Glu-Val-Cys-Glu-Leu-Asn-Pro-Asp-Cys-Asp-Glu-Leu-Ala-Asp-His-Ile-Gly-Phe-Gln-Glu-Ala-Tyr-Arg-Arg-Phe-Tyr-Gly-Pro-Val-OH trifluoroacetate salt (Disulfide bond) |
Availability | July 26, 2024 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Description : | The peptide hormone osteocalcin is involved not only in bone formation, it also plays an important role in glucose metabolism and could regulate testosteron. In mice, only the completely decarboxylated form of the peptide shows the latter hormonal activities, whereas in humans, osteocalcin, partially decarboxylated osteocalcins, and the uncarboxylated peptide seem to be involved. Generally, obese individuals have been shown to have lower osteocalcin(s) levels than non-obese controls, and type 2 diabetic individuals have lower plasma osteocalcin than non-diabetic individuals |
Species : | Human |
Form : | White powder |
Molecular Mass : | 5797.49 |
Protein length : | 1-49 aa |
AA Sequence : | YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV |
Purity : | 95.4% |
Storage : | Store at -20 ± 5 centigrade. |
Reconstitution : | Soluble in DMF at 1 mg/ml |
Tag : | Non |
Publication : |
Osteocalcin and Non-Alcoholic Fatty Liver Disease: Lessons From Two Population-Based Cohorts and Animal Models (2020)
Decarboxylated osteocalcin, a possible drug for type 2 diabetes, triggers glucose uptake in MG63 cells (2021)
|
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Ask a Question for All Osteocalcin Products
Required fields are marked with *
My Review for All Osteocalcin Products
Required fields are marked with *
0
Inquiry Basket