Active Recombinant Full Length Human HSD11B1 Protein, C-Flag-tagged
Cat.No. : | HSD11B1-22HFL |
Product Overview : | Recombinant Full Length Human HSD11B1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Mutations in this gene and H6PD (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) are the cause of cortisone reductase deficiency. Alternate splicing results in multiple transcript variants encoding the same protein. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Enzyme activity |
Molecular Mass : | 32.2 kDa |
AA Sequence : | MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKET LQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSM EVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSI TLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLY STSYNMDRFINKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Protein Pathways : | Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | HSD11B1 hydroxysteroid 11-beta dehydrogenase 1 [ Homo sapiens (human) ] |
Official Symbol | HSD11B1 |
Synonyms | HDL; 11-DH; HSD11; HSD11B; HSD11L; CORTRD2; SDR26C1; 11-beta-HSD1 |
Gene ID | 3290 |
mRNA Refseq | NM_181755.3 |
Protein Refseq | NP_861420.1 |
MIM | 600713 |
UniProt ID | P28845 |
◆ Recombinant Proteins | ||
HSD11B1-1415H | Recombinant Human HSD11B1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HSD11B1-3708HF | Recombinant Full Length Human HSD11B1 Protein, GST-tagged | +Inquiry |
HSD11B1-4330M | Recombinant Mouse HSD11B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HSD11B1-2920R | Recombinant Rat HSD11B1 Protein | +Inquiry |
HSD11B1-2151R | Recombinant Rhesus monkey HSD11B1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD11B1-5381HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
HSD11B1-5380HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD11B1 Products
Required fields are marked with *
My Review for All HSD11B1 Products
Required fields are marked with *
0
Inquiry Basket