Recombinant Human HSD11B1 Protein, GST-tagged
| Cat.No. : | HSD11B1-5060H |
| Product Overview : | Human HSD11B1 full-length ORF ( AAH12593, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq |
| Molecular Mass : | 57.86 kDa |
| AA Sequence : | MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLYSTSYNMDRFINK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HSD11B1 hydroxysteroid (11-beta) dehydrogenase 1 [ Homo sapiens ] |
| Official Symbol | HSD11B1 |
| Synonyms | HSD11B1; hydroxysteroid (11-beta) dehydrogenase 1; HSD11, HSD11B; corticosteroid 11-beta-dehydrogenase isozyme 1; SDR26C1; short chain dehydrogenase/reductase family 26C; member 1; short chain dehydrogenase/reductase family 26C, member 1; HDL; 11-DH; HSD11; HSD11B; HSD11L; 11-beta-HSD1; MGC13539; |
| Gene ID | 3290 |
| mRNA Refseq | NM_001206741 |
| Protein Refseq | NP_001193670 |
| MIM | 600713 |
| UniProt ID | P28845 |
| ◆ Recombinant Proteins | ||
| Hsd11b1-1636M | Recombinant Mouse Hsd11b1 Protein, His-tagged | +Inquiry |
| HSD11B1-3708HF | Recombinant Full Length Human HSD11B1 Protein, GST-tagged | +Inquiry |
| HSD11B1-27736TH | Recombinant Human HSD11B1 | +Inquiry |
| RFL24163OF | Recombinant Full Length Sheep Corticosteroid 11-Beta-Dehydrogenase Isozyme 1(Hsd11B1) Protein, His-Tagged | +Inquiry |
| HSD11B1-238HF | Recombinant Full Length Human HSD11B1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HSD11B1-5380HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
| HSD11B1-5381HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD11B1 Products
Required fields are marked with *
My Review for All HSD11B1 Products
Required fields are marked with *
