Active Recombinant Full Length Human LTC4S Protein, C-Flag-tagged

Cat.No. : LTC4S-487HFL
Product Overview : Recombinant Full Length Human LTC4S Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum.
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Bio-activity : Enzyme activity
Molecular Mass : 16.4 kDa
AA Sequence : MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVA GIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALL
GQLRTLLPWATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Transmembrane
Protein Pathways : Arachidonic acid metabolism, Metabolic pathways
Full Length : Full L.
Gene Name LTC4S leukotriene C4 synthase [ Homo sapiens (human) ]
Official Symbol LTC4S
Synonyms MGC33147
Gene ID 4056
mRNA Refseq NM_145867.2
Protein Refseq NP_665874.1
MIM 246530
UniProt ID Q16873

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LTC4S Products

Required fields are marked with *

My Review for All LTC4S Products

Required fields are marked with *

0

Inquiry Basket

cartIcon