Recombinant Human LTC4S Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LTC4S-4045H
Product Overview : LTC4S MS Standard C13 and N15-labeled recombinant protein (NP_665874) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family includes a number of human proteins, several of which are involved the production of leukotrienes. This gene encodes an enzyme that catalyzes the first step in the biosynthesis of cysteinyl leukotrienes, potent biological compounds derived from arachidonic acid. Leukotrienes have been implicated as mediators of anaphylaxis and inflammatory conditions such as human bronchial asthma. This protein localizes to the nuclear envelope and adjacent endoplasmic reticulum.
Molecular Mass : 16.5 kDa
AA Sequence : MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYFPLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVALAALGLLAHFLPAALRAALLGQLRTLLPWATRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LTC4S leukotriene C4 synthase [ Homo sapiens (human) ]
Official Symbol LTC4S
Synonyms LTC4S; leukotriene C4 synthase; MGC33147; LTC4 synthase;
Gene ID 4056
mRNA Refseq NM_145867
Protein Refseq NP_665874
MIM 246530
UniProt ID Q16873

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LTC4S Products

Required fields are marked with *

My Review for All LTC4S Products

Required fields are marked with *

0
cart-icon
0
compare icon