Active Recombinant Full Length Human PCBP2 Protein, C-Flag-tagged
Cat.No. : | PCBP2-412HFL |
Product Overview : | Recombinant Full Length Human PCBP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. This gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Bio-activity : | Pull-down assay |
Molecular Mass : | 38.5 kDa |
AA Sequence : | MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFK AFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN STERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFP HTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWA GLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQY LINVRLSSETGGMGSSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | PCBP2 poly(rC) binding protein 2 [ Homo sapiens (human) ] |
Official Symbol | PCBP2 |
Synonyms | HNRPE2; HNRNPE2; hnRNP-E2 |
Gene ID | 5094 |
mRNA Refseq | NM_005016.6 |
Protein Refseq | NP_005007.2 |
MIM | 601210 |
UniProt ID | Q15366 |
◆ Recombinant Proteins | ||
PCBP2-611H | Recombinant Human PCBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PCBP2-1406H | Recombinant Human PCBP2 protein, His&Myc-tagged | +Inquiry |
PCBP2-3834H | Recombinant Human PCBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PCBP2-773C | Recombinant Cynomolgus PCBP2 Protein, His-tagged | +Inquiry |
PCBP2-11409Z | Recombinant Zebrafish PCBP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCBP2-3402HCL | Recombinant Human PCBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCBP2 Products
Required fields are marked with *
My Review for All PCBP2 Products
Required fields are marked with *
0
Inquiry Basket