Recombinant Full Length Human PCBP2 Protein
Cat.No. : | PCBP2-361HF |
Product Overview : | Recombinant full length Human PCBP2/hnRNP E2 with a N terminal proprietary tag; Predicted MWt 65.93 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 365 amino acids |
Description : | The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. Thsi gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 65.930kDa inclusive of tags |
AA Sequence : | MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMR EESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLE EDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKI KEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVK QICVVMLESPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGS DSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLT KLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWAGLDA SAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKI ANPVEGSTDRQVTITGSAASISLAQYLINVRLSSETGGMG SS |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | PCBP2 poly(rC) binding protein 2 [ Homo sapiens ] |
Official Symbol | PCBP2 |
Synonyms | PCBP2; poly(rC) binding protein 2; poly(rC)-binding protein 2; heterogenous nuclear ribonucleoprotein E2; hnRNP E2; HNRPE2 |
Gene ID | 5094 |
mRNA Refseq | NM_001098620 |
Protein Refseq | NP_001092090 |
MIM | 601210 |
UniProt ID | Q15366 |
◆ Recombinant Proteins | ||
PCBP2-1406H | Recombinant Human PCBP2 protein, His&Myc-tagged | +Inquiry |
PCBP2-361HF | Recombinant Full Length Human PCBP2 Protein | +Inquiry |
PCBP2-412HFL | Active Recombinant Full Length Human PCBP2 Protein, C-Flag-tagged | +Inquiry |
PCBP2-773C | Recombinant Cynomolgus PCBP2 Protein, His-tagged | +Inquiry |
PCBP2-611H | Recombinant Human PCBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCBP2-3402HCL | Recombinant Human PCBP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PCBP2 Products
Required fields are marked with *
My Review for All PCBP2 Products
Required fields are marked with *
0
Inquiry Basket