Recombinant Full Length Human PCBP2 Protein

Cat.No. : PCBP2-361HF
Product Overview : Recombinant full length Human PCBP2/hnRNP E2 with a N terminal proprietary tag; Predicted MWt 65.93 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 365 amino acids
Description : The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. Thsi gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene.
Form : Liquid
Molecular Mass : 65.930kDa inclusive of tags
AA Sequence : MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMR EESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLE EDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKI KEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVK QICVVMLESPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGS DSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLT KLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWAGLDA SAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKI ANPVEGSTDRQVTITGSAASISLAQYLINVRLSSETGGMG SS
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name PCBP2 poly(rC) binding protein 2 [ Homo sapiens ]
Official Symbol PCBP2
Synonyms PCBP2; poly(rC) binding protein 2; poly(rC)-binding protein 2; heterogenous nuclear ribonucleoprotein E2; hnRNP E2; HNRPE2
Gene ID 5094
mRNA Refseq NM_001098620
Protein Refseq NP_001092090
MIM 601210
UniProt ID Q15366

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PCBP2 Products

Required fields are marked with *

My Review for All PCBP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon