Active Recombinant Human BTC Protein (81 aa)

Cat.No. : BTC-439B
Product Overview : Recombinant Human Betacellulin (BTC) produced in E. coli is a single non-glycosylated polypeptide chain containing 81 amino acids. A fully biologically active molecule, rhBTC has a molecular mass of 15 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 81
Description : Betacellulin (BTC) is a member of the EGF family of growth factors that also includes EGF, TGF-α, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin, Heregulin and Neuregulins. Mature human BTC protein exhibits 80% amino acidsimilarity with mouse BTC protein. BTC is expressed in most tissues including kidney, uterus, liver and pancreas. It is also present in body fluids, including serum, milk, and colostrum. It is synthesized primarily as a transmembrane precursor, which is then processed to a mature molecule by proteolytic events. BTC signals through the EGF receptor.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : The ED50 was determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells is < 0.01 ng/mL, corresponding to a specific activity of >1 × 10^8 units/mg.
Molecular Mass : 15 kDa, observed by reducing SDS-PAGE.
AA Sequence : MDGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant human Betacellulin (BTC) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human Betacellulin (BTC) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name BTC betacellulin [ Homo sapiens ]
Official Symbol BTC
Synonyms BTC; betacellulin; probetacellulin;
Gene ID 685
mRNA Refseq NM_001729
Protein Refseq NP_001720
MIM 600345
UniProt ID P35070

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BTC Products

Required fields are marked with *

My Review for All BTC Products

Required fields are marked with *

0

Inquiry Basket

cartIcon