Active Recombinant Human BTC Protein (81 aa)
Cat.No. : | BTC-439B |
Product Overview : | Recombinant Human Betacellulin (BTC) produced in E. coli is a single non-glycosylated polypeptide chain containing 81 amino acids. A fully biologically active molecule, rhBTC has a molecular mass of 15 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 81 |
Description : | Betacellulin (BTC) is a member of the EGF family of growth factors that also includes EGF, TGF-α, Amphiregulin, HB-EGF, Epiregulin, Tomoregulin, Heregulin and Neuregulins. Mature human BTC protein exhibits 80% amino acidsimilarity with mouse BTC protein. BTC is expressed in most tissues including kidney, uterus, liver and pancreas. It is also present in body fluids, including serum, milk, and colostrum. It is synthesized primarily as a transmembrane precursor, which is then processed to a mature molecule by proteolytic events. BTC signals through the EGF receptor. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | The ED50 was determined by the dose-dependent stimulation of the proliferation of murine Balb/3T3 cells is < 0.01 ng/mL, corresponding to a specific activity of >1 × 10^8 units/mg. |
Molecular Mass : | 15 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MDGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFY |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE. |
Storage : | Lyophilized recombinant human Betacellulin (BTC) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human Betacellulin (BTC) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | BTC betacellulin [ Homo sapiens ] |
Official Symbol | BTC |
Synonyms | BTC; betacellulin; probetacellulin; |
Gene ID | 685 |
mRNA Refseq | NM_001729 |
Protein Refseq | NP_001720 |
MIM | 600345 |
UniProt ID | P35070 |
◆ Recombinant Proteins | ||
BTC-1240C | Recombinant Chicken BTC | +Inquiry |
BTC-1665HF | Recombinant Full Length Human BTC Protein, GST-tagged | +Inquiry |
BTC-869H | Recombinant Human Betacellulin, His-tagged | +Inquiry |
BTC-208R | Active Recombinant Rhesus BTC protein, hFc-tagged | +Inquiry |
BTC-008H | Active Recombinant Human BTC Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTC-2505MCL | Recombinant Mouse BTC cell lysate | +Inquiry |
BTC-1049CCL | Recombinant Cynomolgus BTC cell lysate | +Inquiry |
BTC-933HCL | Recombinant Human BTC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BTC Products
Required fields are marked with *
My Review for All BTC Products
Required fields are marked with *
0
Inquiry Basket