Recombinant Full Length Human Probetacellulin(Btc) Protein, His-Tagged
Cat.No. : | RFL14405HF |
Product Overview : | Recombinant Full Length Human Probetacellulin(BTC) Protein (P35070) (32-178aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (32-178) |
Form : | Lyophilized powder |
AA Sequence : | DGNSTRSPETNGLLCGDPEENCAATTTQSKRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQILVICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | BTC |
Synonyms | BTCProbetacellulin [Cleaved into: Betacellulin; BTC)] |
UniProt ID | P35070 |
◆ Recombinant Proteins | ||
BTC-10315H | Recombinant Human BTC, GST-tagged | +Inquiry |
BTC-26709TH | Recombinant Human BTC | +Inquiry |
BTC-008H | Active Recombinant Human BTC Protein | +Inquiry |
BTC-395H | Active Recombinant Human BTC protein(Met1-Tyr111), hFc-tagged | +Inquiry |
BTC-2904H | Recombinant Human BTC protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
BTC-933HCL | Recombinant Human BTC cell lysate | +Inquiry |
BTC-2505MCL | Recombinant Mouse BTC cell lysate | +Inquiry |
BTC-1049CCL | Recombinant Cynomolgus BTC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BTC Products
Required fields are marked with *
My Review for All BTC Products
Required fields are marked with *