Species : |
Human |
Source : |
CHO |
Description : |
Human Granulocyte Colony Stimulating Factor (G-CSF) contains internal disulfide bonds. Among the family of colony-stimulating factors, Granulocyte Colony Stimulating Factor (G-CSF) is the most potent inducer of terminal differentiation to granulocytes and macrophages of leukemic myeloid cell lines. The synthesis of Granulocyte Colony Stimulating Factor (G-CSF) can be induced by bacterial endotoxins, TNF, Interleukin-1 and GM-CSF. Prostaglandin E2 inhibits the synthesis of Granulocyte Colony Stimulating Factor (G-CSF). In epithelial, endothelial, and fibroblastic cells, the secretion of Granulocyte Colony Stimulating Factor (G-CSF) is induced by Interleukin-17. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50< 0.1 ng/mL, determined by the dose-dependent stimulation of the proliferation of murine M-NFS-60 cells, corresponding to a specific activity of >1 × 10^7 units/mg. |
Molecular Mass : |
18.7kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : |
TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% as analyzed by SDS-PAGE and HPLC. |
Storage : |
Lyophilized recombinant human Granulocyte Colony Stimulating Factor (G-CSF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhG-CSF should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |