Active Recombinant Human FGF12 Protein (181 aa)

Cat.No. : FGF12-419F
Product Overview : Recombinant human Fibroblast Growth Factor-12 (rhFGF-12) produced in E. coli is a single non-glycosylated polypeptide chain containing 181 amino acids. A fully biologically active molecule, rhFGF-12 has a molecular mass of 20.4 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 181
Description : Fibroblast Growth Factor-12(FGF-12) is a heparin binding cytokine belonging to the FGF family. FGF-12 along with FGF-11, -13, and -14, form a sublineage within the FGF family: in contrast to the other members, they are all intracellular signaling proteins lacking signal peptides and containing a flanking domain beside the family conserved β-trefoil domain. FGF-12 is expressed in the cartilaginous skeleton and heart, suggesting a role in the development of connective tissue and heart. In vivo, FGF-12 binds to Islet Brain-2 and Voltage-Gated Sodium Channels (VGSC), and plays a critical role in the membrane targeting and function of VGSC. FGF-12 has been implicated in heart diseases such as cardiac arrhythmias.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 20 ng/mL, measured by its binding ability in a functional ELISA with immobilized rhFGF R4/Fc Chimera, corresponding to a specific activity of > 5 × 10^4 units/mg.
Molecular Mass : 20.4 kDa, observed by reducing SDS-PAGE.
AA Sequence : MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant human Fibroblast Growth Factor-12 (rhFGF-12) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-12 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name FGF12 fibroblast growth factor 12 [ Homo sapiens ]
Official Symbol FGF12
Synonyms FGF12; fibroblast growth factor 12; FGF12B; FHF1; fibroblast growth factor 12B; fibroblast growth factor FGF 12b; fibroblast growth factor homologous factor 1; myocyte activating factor; FHF-1; FGF-12; myocyte-activating factor; fibroblast growth factor FGF-12b;
Gene ID 2257
mRNA Refseq NM_004113
Protein Refseq NP_004104
MIM 601513
UniProt ID P61328

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF12 Products

Required fields are marked with *

My Review for All FGF12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon