| Species : |
Human |
| Source : |
E.coli |
| Protein Length : |
181 |
| Description : |
Fibroblast Growth Factor-12(FGF-12) is a heparin binding cytokine belonging to the FGF family. FGF-12 along with FGF-11, -13, and -14, form a sublineage within the FGF family: in contrast to the other members, they are all intracellular signaling proteins lacking signal peptides and containing a flanking domain beside the family conserved β-trefoil domain. FGF-12 is expressed in the cartilaginous skeleton and heart, suggesting a role in the development of connective tissue and heart. In vivo, FGF-12 binds to Islet Brain-2 and Voltage-Gated Sodium Channels (VGSC), and plays a critical role in the membrane targeting and function of VGSC. FGF-12 has been implicated in heart diseases such as cardiac arrhythmias. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
ED50 < 20 ng/mL, measured by its binding ability in a functional ELISA with immobilized rhFGF R4/Fc Chimera, corresponding to a specific activity of > 5 × 10^4 units/mg. |
| Molecular Mass : |
20.4 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : |
MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREPSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST |
| Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
| Purity : |
> 95% as analyzed by SDS-PAGE and HPLC. |
| Storage : |
Lyophilized recombinant human Fibroblast Growth Factor-12 (rhFGF-12) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-12 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
| Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |