Active Recombinant Human FGF21 Protein
Cat.No. : | FGF21-85H |
Product Overview : | Recombinant Human FGF21 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Fibroblast growth factor 21 (FGF-21) is an endocrine hormone that regulates energy homeostasis and exerts cardioprotective functions during heart injury. FGF-21 is expressed in the liver, pancreas, heart, and adipose tissues. FGF-21 signaling is activated through the FGFR1c receptor and β-Klotho co-receptor. FGF-21 is an important regulator of glucose uptake and reduces cell apoptosis under stress conditions. |
Bio-activity : | 3T3 proliferation with β-klotho and heparin, ED50≤500 ng/mL (≥2.0 x 10^3 unit/mg) |
Molecular Mass : | Monomer, 19.5 kDa (182 aa) |
AA Sequence : | MHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 100 mM sodium chloride, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | FGF21 fibroblast growth factor 21 [ Homo sapiens (human) ] |
Official Symbol | FGF21 |
Synonyms | FGF21; fibroblast growth factor 21; FGF-21; |
Gene ID | 26291 |
mRNA Refseq | NM_019113 |
Protein Refseq | NP_061986 |
MIM | 609436 |
UniProt ID | Q9NSA1 |
◆ Recombinant Proteins | ||
Fgf21-5453M | Recombinant Mouse Fgf21 Protein (Ala29-Ser210), N-His tagged | +Inquiry |
FGF21-933P | Recombinant Pig FGF21 Protein, His-tagged | +Inquiry |
Fgf21-194R | Recombinant Rat Pdgfa protein, His/S-tagged | +Inquiry |
FGF21-947HFL | Recombinant Full Length Human FGF21 Protein, C-Flag-tagged | +Inquiry |
FGF21-1567H | Recombinant Human FGF21 protein, mFc-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF21-1890MCL | Recombinant Mouse FGF21 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF21 Products
Required fields are marked with *
My Review for All FGF21 Products
Required fields are marked with *