Active Recombinant Human FGF4 Protein
Cat.No. : | FGF4-87H |
Product Overview : | Recombinant Human FGF4 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Fibroblast growth factor 4 (FGF-4) is a secreted growth factor that is predominantly expressed during bone morphogenesis and embryonic limb development. FGF-4 is an important growth regulator for stem cells, fibroblasts, and endothelial cells. FGF-4 contains a single N-linked glycosylation signal. In-vitro studies suggest that unglycosylated FGF-4 is cleaved into 13 kDa and 15 kDa truncated proteins that have greater biological activity than the wild type 19 kDa FGF-4 protein. Human FGF-4 shares high homology and is cross-reactive with mouse FGF-4. |
Bio-activity : | NR6R-3T3 Proliferation, ED50≤5 ng/mL |
Molecular Mass : | Monomer, 19.4 kDa (177 aa) |
AA Sequence : | MAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, 75 mM sodium chloride, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | FGF4 fibroblast growth factor 4 [ Homo sapiens (human) ] |
Official Symbol | FGF4 |
Synonyms | FGF4; fibroblast growth factor 4; heparin secretory transforming protein 1 , HSTF1; HBGF 4; HST; HST 1; human stomach cancer; transforming factor from FGF related oncogene; K FGF; kaposi sarcoma oncogene; KFGF; transforming protein KS3; FGF-4; HSTF-1; oncogene HST; heparin-binding growth factor 4; heparin secretory transforming protein 1; heparin secretory-transforming protein 1; fibroblast growth factor 4 splice isoform; human stomach cancer, transforming factor from FGF-related oncogene; HST-1; HSTF1; K-FGF; HBGF-4; |
Gene ID | 2249 |
mRNA Refseq | NM_002007 |
Protein Refseq | NP_001998 |
MIM | 164980 |
UniProt ID | P08620 |
◆ Recombinant Proteins | ||
FGF4-023E | Active Recombinant Human FGF4 (54 - 206aa) | +Inquiry |
FGF4-167H | Recombinant Human FGF4 protein | +Inquiry |
FGF4-263H | Recombinant Human fibroblast growth factor 4 Protein, His tagged | +Inquiry |
FGF4-96H | Active Recombinant Human FGF4 Protein (Gly25-Leu206), C-His tagged, Animal-free, Carrier-free | +Inquiry |
FGF4-5853M | Recombinant Mouse FGF4 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF4 Products
Required fields are marked with *
My Review for All FGF4 Products
Required fields are marked with *
0
Inquiry Basket