Species : |
Human |
Source : |
E.coli |
Protein Length : |
164 |
Description : |
Keratinocyte Growth Factor-1 (KGF-1/FGF-7) is one of 23 known members of the FGF family. All FGFs have two conserved cysteine residues and share 30 - 50% sequence identity at the amino acid level. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of variety of tissues, by promoting cellular proliferation and differentiation. KGF-1/FG-7 is a mitogen factor specific for epithelial cells and keratinocytes and signals through FGFR 2b. KGF-1/FGF-7 plays a role in kidney and lung development, angiogenesis, and wound healing. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
The biological activity was determined by the does-dependent stimulation of thymidine uptake by BaF3 cells expressing KGF receptors yielding an ED50 < 10 ng/mL,corresponding to a specific activity of ≥ 1 × 10^5 units/mg. |
Molecular Mass : |
Approximately 19.0 kDa, a single, non-glycosylated polypeptide chain containing 164 amino acids. |
AA Sequence : |
MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
Endotoxin : |
Less than 1 EU/mg of rHuKGF-1 as determined by LAL method. |
Purity : |
>96% by SDS-PAGE and HPLC analyses. |
Storage : |
This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : |
Lyophilized from a 0.2mm filtered solution in 20mM PB, pH 8.0, 1M NaCl. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |