Active Recombinant Human FGF7 Protein (164 aa)

Cat.No. : FGF7-087F
Product Overview : Recombinant Human FGF7 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 164
Description : Keratinocyte Growth Factor-1 (KGF-1/FGF-7) is one of 23 known members of the FGF family. All FGFs have two conserved cysteine residues and share 30 - 50% sequence identity at the amino acid level. Proteins of this family play a central role during prenatal development and postnatal growth and regeneration of variety of tissues, by promoting cellular proliferation and differentiation. KGF-1/FG-7 is a mitogen factor specific for epithelial cells and keratinocytes and signals through FGFR 2b. KGF-1/FGF-7 plays a role in kidney and lung development, angiogenesis, and wound healing.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : The biological activity was determined by the does-dependent stimulation of thymidine uptake by BaF3 cells expressing KGF receptors yielding an ED50 < 10 ng/mL,corresponding to a specific activity of ≥ 1 × 10^5 units/mg.
Molecular Mass : Approximately 19.0 kDa, a single, non-glycosylated polypeptide chain containing 164 amino acids.
AA Sequence : MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT
Endotoxin : Less than 1 EU/mg of rHuKGF-1 as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable for several weeks at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered solution in 20mM PB, pH 8.0, 1M NaCl.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name FGF7 fibroblast growth factor 7 [ Homo sapiens ]
Official Symbol FGF7
Synonyms FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7;
Gene ID 2252
mRNA Refseq NM_002009
Protein Refseq NP_002000
MIM 148180
UniProt ID P21781

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF7 Products

Required fields are marked with *

My Review for All FGF7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon