Active Recombinant Human FGF7 Protein (164 aa)
Cat.No. : | FGF7-345F |
Product Overview : | Recombinant human Keratinocyte Growth Factor (rhKGF) produced in E. coli is a single non-glycosylated polypeptide chain containing 164 amino acids. A fully biologically active molecule, rhKGF has a molecular mass of 19.0 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 164 |
Description : | Keratinocyte Growth Factor (KGF) is a highly specific epithelial mitogen produced by fibroblasts and mesenchymal stem cells. KGF belongs to the heparin binding Fibroblast Growth Factor (FGF) family, and is known as FGF-7. However, in contrast to the FGF-1, which binds to all known FGF receptors with high affinity, KGF only binds to a splice variant of an FGF receptor, FGFR2-IIIb. FGFR2-IIIb is produced by most of the epithelial cells, indicating that KGF plays roles as a paracrine mediator. KGF induces the differen-tiation and proliferation of various epithelial cells, including keratinocytes in the epidermis, hair follicles and sebaceous glands, and is responsible for the wound repairs of various tissues, including lung, bladder, and kidney. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 2 ng/mL, measured by a cell proliferation assay using 4MBr-5 cells, corresponding to a specific activity of > 5.0 × 10^5 units/mg. |
Molecular Mass : | 19.0 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MCNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant human Keratinocyte Growth Factor (rhKGF) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhKGF should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | FGF7 fibroblast growth factor 7 [ Homo sapiens ] |
Official Symbol | FGF7 |
Synonyms | FGF7; fibroblast growth factor 7; fibroblast growth factor 7 (keratinocyte growth factor); keratinocyte growth factor; KGF; FGF-7; heparin-binding growth factor 7; HBGF-7; |
Gene ID | 2252 |
mRNA Refseq | NM_002009 |
Protein Refseq | NP_002000 |
MIM | 148180 |
UniProt ID | P21781 |
◆ Recombinant Proteins | ||
FGF7-594H | Active Recombinant Human FGF7 protein, His-tagged | +Inquiry |
Fgf7-500M | Recombinant Mouse Fgf7 protein(Cys32-Thr194), His-tagged | +Inquiry |
FGF7-410H | Active Recombinant Human FGF7 Protein | +Inquiry |
Fgf7-372R | Active Recombinant Rat Fibroblast Growth Factor 7 | +Inquiry |
FGF7-229F | Active Recombinant Human FGF7 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF7-6236HCL | Recombinant Human FGF7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All FGF7 Products
Required fields are marked with *
My Review for All FGF7 Products
Required fields are marked with *
0
Inquiry Basket