Active Recombinant Human IFN-alpha 2a Protein
Cat.No. : | IFNA2-113H |
Product Overview : | Recombinant Human IFN-alpha 2a Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Interferon-alpha 2a (IFN-α 2a) is a type I interferon made by leukocytes during viral infection. The JAK-STAT pathway mediates the antiviral and anti-cell proliferation activities of IFN-α 2a. IFN-α proteins are widely used as standard treatments during antiviral and antineoplastic therapies. The IFN-α 2a variant differs from IFN-α 2b by one amino acid. |
Bio-activity : | Viral CPE assay using EMC virus on A549 cells, ≤NA; ≥2.0 x 10^8 units/mg |
Molecular Mass : | Monomer, 19.4 kDa (166 aa) |
AA Sequence : | MCDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | IFNA2 interferon, alpha 2 [ Homo sapiens (human) ] |
Official Symbol | IFNA2 |
Synonyms | IFNA2; interferon, alpha 2; interferon alpha-2; alpha 2a interferon; IFN alphaA; IFNA; interferon alpha 2b; interferon alpha A; leIF A; IFN-alpha-2; alpha-2a interferon; INFA2; IFNA2B; IFN-alphaA; MGC125764; MGC125765; |
Gene ID | 3440 |
mRNA Refseq | NM_000605 |
Protein Refseq | NP_000596 |
MIM | 147562 |
UniProt ID | P01563 |
◆ Recombinant Proteins | ||
SOCS7-8387Z | Recombinant Zebrafish SOCS7 | +Inquiry |
TSHR-0782H | Recombinant Human TSHR protein, Fc-tagged | +Inquiry |
DKK1-2062H | Recombinant Human DKK1 Protein (Thr32-His266), N-8×His tagged | +Inquiry |
BCCIP-622H | Recombinant Human BCCIP Protein, His&GST-tagged | +Inquiry |
RFL31135SF | Recombinant Full Length Suncus Murinus Mitochondrial Brown Fat Uncoupling Protein 1(Ucp1) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
GG-185R | Native Rabbit Gamma Globulin protein | +Inquiry |
CHC-001C | Native Clostridium Histolyticum Collagenase, Tag Free | +Inquiry |
Lectin-8983P | Active Native Phaseolus vulgaris (red kidney bean) Lectin | +Inquiry |
IgA-204M | Native Monkey Immunoglobulin A | +Inquiry |
Collagen-319H | Native Human Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
TGFBR1-2482HCL | Recombinant Human TGFBR1 cell lysate | +Inquiry |
Pancreas-367R | Rat Pancreas Membrane Lysate | +Inquiry |
HIST1H1E-5551HCL | Recombinant Human HIST1H1E 293 Cell Lysate | +Inquiry |
C9orf78-7925HCL | Recombinant Human C9orf78 293 Cell Lysate | +Inquiry |
ZNF514-2044HCL | Recombinant Human ZNF514 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNA2 Products
Required fields are marked with *
My Review for All IFNA2 Products
Required fields are marked with *
0
Inquiry Basket