Active Recombinant Human IGF2 Protein (68 aa)
Cat.No. : | IGF2-373I |
Product Overview : | Recombinant human Insulin-like Growth Factor II (rhIGF-II) produced in E. coli is a single non-glycosylated polypeptide chain containing 68 amino acids. A fully biologically active molecule, rhIGF-II has a molecular mass of 7.6 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 68 |
Description : | Insulin-like Growth Factor II (IGF-II) is a single chain 7 kDa polypeptide, and shares a high degree of homology with insulin. During circulation in vivo, IGF-II is complexed to high affinity binding proteins, IGF Binding Proteins (IGFBP), which act as circulating reservoirs, transport IGF-II, and prolong the half life of IGF-II. The receptors of IGF-II (IGFRs) are transmembrane tyrosine receptors, and are heterotetrameric consisting of two α-subunits and two β-subunits. IGFRs execute their role via intracellullar signaling molecules, such as IRS, shc, and PI3K. The functions of IGF-II include promoting cell survival, growth, proliferation, differentiation and motility. In particular, IGF-II promotes proliferation, inhibits death, and stimulates transformation in breast cancer cells. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 20 ng/mL, measured by a cell proliferation assay using FDCP-1 cells, corresponding to a specific activity of > 5 × 10^4 units/mg. |
Molecular Mass : | 7.6 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | MAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant human Insulin-like Growth Factor II (rhIGF-II) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIGF-II remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against 25mM Tris, pH8.0. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | IGF2 insulin-like growth factor 2 (somatomedin A) [ Homo sapiens ] |
Official Symbol | IGF2 |
Synonyms | IGF2; insulin-like growth factor 2 (somatomedin A); C11orf43, chromosome 11 open reading frame 43; insulin-like growth factor II; FLJ44734; somatomedin-A; insulin-like growth factor type 2; IGF-II; PP9974; C11orf43; FLJ22066; |
Gene ID | 3481 |
mRNA Refseq | NM_000612 |
Protein Refseq | NP_000603 |
MIM | 147470 |
UniProt ID | P01344 |
◆ Recombinant Proteins | ||
IGF2-037H | Recombinant Human IGF2 Protein | +Inquiry |
IGF2-692H | Recombinant Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
Igf2-1224M | Active Recombinant Mouse Igf2 Protein | +Inquiry |
IGF2-8065M | Recombinant Mouse IGF2 Protein | +Inquiry |
IGF2-5431H | Recombinant Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
◆ Native Proteins | ||
IGF2-621H | Native Human Insulin-Like Growth Factor 2 (somatomedin A) | +Inquiry |
IGF2-29116TH | Native Human IGF2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF2-5267HCL | Recombinant Human IGF2 293 Cell Lysate | +Inquiry |
IGF2-5266HCL | Recombinant Human IGF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF2 Products
Required fields are marked with *
My Review for All IGF2 Products
Required fields are marked with *
0
Inquiry Basket