Active Recombinant Human IGF2 Protein (68 aa)

Cat.No. : IGF2-373I
Product Overview : Recombinant human Insulin-like Growth Factor II (rhIGF-II) produced in E. coli is a single non-glycosylated polypeptide chain containing 68 amino acids. A fully biologically active molecule, rhIGF-II has a molecular mass of 7.6 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 68
Description : Insulin-like Growth Factor II (IGF-II) is a single chain 7 kDa polypeptide, and shares a high degree of homology with insulin. During circulation in vivo, IGF-II is complexed to high affinity binding proteins, IGF Binding Proteins (IGFBP), which act as circulating reservoirs, transport IGF-II, and prolong the half life of IGF-II. The receptors of IGF-II (IGFRs) are transmembrane tyrosine receptors, and are heterotetrameric consisting of two α-subunits and two β-subunits. IGFRs execute their role via intracellullar signaling molecules, such as IRS, shc, and PI3K. The functions of IGF-II include promoting cell survival, growth, proliferation, differentiation and motility. In particular, IGF-II promotes proliferation, inhibits death, and stimulates transformation in breast cancer cells.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 20 ng/mL, measured by a cell proliferation assay using FDCP-1 cells, corresponding to a specific activity of > 5 × 10^4 units/mg.
Molecular Mass : 7.6 kDa, observed by reducing SDS-PAGE.
AA Sequence : MAYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant human Insulin-like Growth Factor II (rhIGF-II) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhIGF-II remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 25mM Tris, pH8.0.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name IGF2 insulin-like growth factor 2 (somatomedin A) [ Homo sapiens ]
Official Symbol IGF2
Synonyms IGF2; insulin-like growth factor 2 (somatomedin A); C11orf43, chromosome 11 open reading frame 43; insulin-like growth factor II; FLJ44734; somatomedin-A; insulin-like growth factor type 2; IGF-II; PP9974; C11orf43; FLJ22066;
Gene ID 3481
mRNA Refseq NM_000612
Protein Refseq NP_000603
MIM 147470
UniProt ID P01344

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IGF2 Products

Required fields are marked with *

My Review for All IGF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon