Active Recombinant Human IL10 Protein
Cat.No. : | IL10-262I |
Product Overview : | Recombinant Human IL10 Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | CHO |
Description : | Interleukin-10 (IL-10), initially known as Cytokine Synthesis Inhibitory Factor (CSIF), belongs to the IL-10 family and shares more than 80% sequence homology with Epstein-Barr Virus protein BCRFI. It is produced by many immune cells, such as T-cells, macrophages, mast cells, and dendritic cells. It is usually secreted as a homodimer and, upon binding to its receptor, inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and Th2 cells. It also displays ability to suppress Antigen-Presenting Cell (APC) function. The net effect of Interleukin-10 appears to be inhibitory; however, stimulatory effects, such as stimulation of B cell maturation and antibody production, are also reported. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 0.2 ng/mL, measured in a cell proliferation assay using MC/9 cells. |
Molecular Mass : | 18-19 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQMKDQLDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIRN |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Human Interleukin-10 remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interleukin-10 should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | IL10 interleukin 10 [ Homo sapiens ] |
Official Symbol | IL10 |
Synonyms | IL10; interleukin 10; interleukin-10; CSIF; cytokine synthesis inhibitory factor; IL 10; IL10A; T cell growth inhibitory factor; TGIF; T-cell growth inhibitory factor; GVHDS; IL-10; MGC126450; MGC126451; |
Gene ID | 3586 |
mRNA Refseq | NM_000572 |
Protein Refseq | NP_000563 |
MIM | 124092 |
UniProt ID | P22301 |
◆ Recombinant Proteins | ||
IL10-14140H | Recombinant Human IL10, GST-tagged | +Inquiry |
IL10-838H | Recombinant Horse IL10 protein, His & GST-tagged | +Inquiry |
IL10-217H | Recombinant Human Interleukin 10 | +Inquiry |
IL10-128M | Active Recombinant Mouse IL10 Protein | +Inquiry |
IL10-4294H | Recombinant Human IL10 Protein (Ser19-Asn178), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10-2079HCL | Recombinant Human IL10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL10 Products
Required fields are marked with *
My Review for All IL10 Products
Required fields are marked with *
0
Inquiry Basket