Active Recombinant Human IL15 Protein

Cat.No. : IL15-134H
Product Overview : Recombinant Human IL15 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Interleukin 15 (IL-15) is a widely expressed proinflammatory cytokine that is structurally and functionally related to interleukin 2 (IL-2). IL-15 signals through JAK kinases to activate STAT3, STAT5, and STAT6 transcription factors. IL-15 regulates the activation of T cells, neutrophils, and macrophages, and is a stimulatory cytokine promoting dendritic cell function. IL-15 expression is dysregulated in chronic inflammatory disorders, including rheumatoid arthritis, psoriasis, and pulmonary inflammatory diseases. Therefore, IL-15 may serve as an effective therapeutic target, due to the beneficial outcomes of IL-15 neutralization in models of psoriasis and diabetes. Human IL-15 shows activity on mouse cells.
Bio-activity : CTLL-2 cell proliferation, ≤5 ng/mL
Molecular Mass : Monomer, 12.9 kDa (115 aa)
AA Sequence : MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium bicarbonate, pH 8.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name IL15 interleukin 15 [ Homo sapiens (human) ]
Official Symbol IL15
Synonyms IL15; interleukin 15; interleukin-15; IL 15; MGC9721; IL-15;
Gene ID 3600
mRNA Refseq NM_000585
Protein Refseq NP_000576
MIM 600554
UniProt ID P40933

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL15 Products

Required fields are marked with *

My Review for All IL15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon