Active Recombinant Human IL15 Protein
Cat.No. : | IL15-100H |
Product Overview : | Recombinant Human Interleukin-15 is produced by our E.coli expression system and the target gene encoding Asn49-Ser162 is expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | Asn49-Ser162 |
Description : | Human Interleukin 15 (IL-15) is a cytokine that regulates T cell and natural killer cell activation and proliferation. IL-15 binds to the alpha subunit of the IL15 receptor (IL-15RA) with high affinity. IL-15 also binds to the beta and gamma chains of the IL-2 receptor, but not the alpha subunit of the IL2 receptor. IL-15 is structurally and functionally related to IL-2. Both cytokines share some subunits of receptors, allowing them to compete for and negatively regulate each other's activity. The number of CD8+ memory T cells is controlled by a balance between IL-15 and IL-2. Despite their many overlapping functional properties, IL-2 and IL-15 are, in fact, quite distinct players in the immune system. IL-15 is constitutively expressed by a wide variety of cell types and tissues, including monocytes, macrophages and DCs. Mature Human IL-15 shares 70% amino acid sequence identity with Mouse and Rat IL-15. |
Form : | Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.0. |
Bio-activity : | Specific Activity is greater than 1.5 x 10^7 IU/mg. Measured by a viral resistance assay using VSV-WISH cells. |
AA Sequence : | NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILAN NSLSSNGNVTESGCKE CEELEEKNIKEFLQSFVHIVQMFINTS |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | IL15 interleukin 15 [ Homo sapiens (human) ] |
Official Symbol | IL15 |
Synonyms | Interleukin-15; IL-15 |
Gene ID | 3600 |
mRNA Refseq | NM_000585.5 |
Protein Refseq | NP_000576.1 |
MIM | 600554 |
UniProt ID | P40933 |
◆ Recombinant Proteins | ||
IL15-8119M | Recombinant Mouse IL15 Protein | +Inquiry |
IL15-483H | Active Recombinant Human Interleukin 15 | +Inquiry |
IL15-4494M | Recombinant Mouse IL15 Protein, His (Fc)-Avi-tagged | +Inquiry |
IL15-01R | Recombinant Rhesus Monkey IL15 Protein, His-tagged | +Inquiry |
Il15-231R | Recombinant Rat Interleukin 15 | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL15-5248HCL | Recombinant Human IL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL15 Products
Required fields are marked with *
My Review for All IL15 Products
Required fields are marked with *
0
Inquiry Basket