Active Recombinant Human IL17A Protein

Cat.No. : IL17A-102H
Product Overview : Recombinant Human Interleukin-17A is produced by our E.coli expression system and the target gene encoding Ile20-Ala155 is expressed.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : Ile20-Ala155
Description : Interleukin-17 is a potent pro-inflammatory cytokine produced by activated memory T cells. There are at least six members of the IL-17 family in humans and in mice. As IL-17 shares properties with IL-1 and TNF-alpha, it may induce joint inflammation and bone and cartilage destruction. This cytokine is found in synovial fluids of patients with rheumatoid arthritis, and produced by rheumatoid arthritis synovium. It increases IL-6 production, induces collagen degradation and decreases collagen synthesis by synovium and cartilage and proteoglycan synthesis in cartilage. IL-17 is also able to increase bone destruction and reduce its formation. Blocking of interleukin-17 with specific inhibitors provides a protective inhibition of cartilage and bone degradation.
Form : Lyophilized from a 0.2 um filtered solution of 20mM PB, pH 7.4.
Bio-activity : ED50 is approximately 2 ng/ml. Specific Activity of 5 x 10^5 IU/mg. Measured by the dose-dependent induction of IL-6 in primary human foreskin fibroblasts.
AA Sequence : MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERY PSVIWEAKCRHLGCIN ADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Endotoxin : Less than 0.1 ng/ug (1 EU/ug).
Purity : >95%
Storage : Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.
Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Quality Statement : Purity: Greater than 95% as determined by reducing SDS-PAGE.
Shipping : The product is shipped at ambient temperature.
Upon receipt, store it immediately at the temperature listed below.
Gene Name IL17A interleukin 17A [ Homo sapiens (human) ]
Official Symbol IL17A
Synonyms Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A
Gene ID 3605
mRNA Refseq NM_002190.3
Protein Refseq NP_002181.1
MIM 603149
UniProt ID Q16552

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL17A Products

Required fields are marked with *

My Review for All IL17A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon