Active Recombinant Human IL4 Protein (130 aa)

Cat.No. : IL4-094I
Product Overview : Recombinant Human IL4 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 130
Description : Interleukin-4 is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. Produced by mast cells, T cells and bone marrow stromal cells, IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergy.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by the dose-dependant stimulation of TF1 cells is less than 0.2 ng/mL, corresponding to a Specific Activity of >5 × 10^6 IU/mg.
Molecular Mass : Approximately 15 kDa, a single non-glycosylated polypeptide chain containing 130 amino acids.
AA Sequence : MHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Endotoxin : Less than 1 EU/mg of rHuIL-4 as determined by LAL method.
Purity : >95% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IL4 interleukin 4 [ Homo sapiens ]
Official Symbol IL4
Synonyms IL4; interleukin 4; interleukin-4; B cell growth factor 1; B_cell stimulatory factor 1; BCGF 1; BCGF1; BSF1; IL 4; lymphocyte stimulatory factor 1; MGC79402; binetrakin; pitrakinra; IL-4; BSF-1; BCGF-1;
Gene ID 3565
mRNA Refseq NM_000589
Protein Refseq NP_000580
MIM 147780
UniProt ID P05112

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL4 Products

Required fields are marked with *

My Review for All IL4 Products

Required fields are marked with *

0
cart-icon