Active Recombinant Human INHBB Protein
Cat.No. : | INHBB-5119H |
Product Overview : | Human INHBB (P09529) partial recombinant protein expressed in Hi-5 (BTI-Tn-5B1-4) cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | Non |
Description : | The inhibin beta B subunit joins the alpha subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. Because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Furthermore, the beta B subunit forms a homodimer, activin B, and also joins with the beta A subunit to form a heterodimer, activin AB, both of which stimulate FSH secretion. [provided by RefSeq |
Form : | Lyophilized |
Bio-activity : | The ED50 as determined by its ability to inhibit the proliferation of murine MPC-11 cells is <= 2.0 ng/mL, corresponding to a specific activity of >= 5 x 105 units/mg. |
Molecular Mass : | 25.6 kDa |
AA Sequence : | GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA |
Endotoxin : | Endotoxin level is < 0.1 ng/μg of protein (< 1 EU/μg). |
Purity : | 95% |
Applications : | Functional Study SDS-PAGE |
Usage : | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
Storage : | Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | Lyophilized from solutions contain no sodiun azide nor carrier protein |
Gene Name | INHBB inhibin, beta B [ Homo sapiens ] |
Official Symbol | INHBB |
Synonyms | INHBB; inhibin, beta B; inhibin, beta B (activin AB beta polypeptide); inhibin beta B chain; Inhibin, beta-2; activin beta-B chain; activin AB beta polypeptide; MGC157939; |
Gene ID | 3625 |
mRNA Refseq | NM_002193 |
Protein Refseq | NP_002184 |
MIM | 147390 |
UniProt ID | P09529 |
◆ Recombinant Proteins | ||
Activin-B-3122H | Recombinant Human Activin-B | +Inquiry |
INHBB-956H | Active Recombinant Human INHBB Protein | +Inquiry |
INHBB-6759C | Recombinant Chicken INHBB | +Inquiry |
INHBB-5119H | Active Recombinant Human INHBB Protein | +Inquiry |
INHBB-2885H | Recombinant Human Activin B | +Inquiry |
◆ Cell & Tissue Lysates | ||
INHBB-2612HCL | Recombinant Human INHBB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All INHBB Products
Required fields are marked with *
My Review for All INHBB Products
Required fields are marked with *
0
Inquiry Basket