Active Recombinant Human INHBB Protein

Cat.No. : INHBB-5119H
Product Overview : Human INHBB (P09529) partial recombinant protein expressed in Hi-5 (BTI-Tn-5B1-4) cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : Non
Description : The inhibin beta B subunit joins the alpha subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. Because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Furthermore, the beta B subunit forms a homodimer, activin B, and also joins with the beta A subunit to form a heterodimer, activin AB, both of which stimulate FSH secretion. [provided by RefSeq
Form : Lyophilized
Bio-activity : The ED50 as determined by its ability to inhibit the proliferation of murine MPC-11 cells is <= 2.0 ng/mL, corresponding to a specific activity of >= 5 x 105 units/mg.
Molecular Mass : 25.6 kDa
AA Sequence : GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA
Endotoxin : Endotoxin level is < 0.1 ng/μg of protein (< 1 EU/μg).
Purity : 95%
Applications : Functional Study
SDS-PAGE
Usage : Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage : Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : Lyophilized from solutions contain no sodiun azide nor carrier protein
Gene Name INHBB inhibin, beta B [ Homo sapiens ]
Official Symbol INHBB
Synonyms INHBB; inhibin, beta B; inhibin, beta B (activin AB beta polypeptide); inhibin beta B chain; Inhibin, beta-2; activin beta-B chain; activin AB beta polypeptide; MGC157939;
Gene ID 3625
mRNA Refseq NM_002193
Protein Refseq NP_002184
MIM 147390
UniProt ID P09529

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INHBB Products

Required fields are marked with *

My Review for All INHBB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon