Active Recombinant Human INHBB Protein
Cat.No. : | INHBB-956H |
Product Overview : | Recombinant Human INHBB was expressed in Hi-5 insect cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Hi-5 Insect Cells |
Tag : | Non |
Description : | Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2 |
Bio-activity : | ED50 was determined by its ability to inhibit the proliferation of murine MPC-11 cells is less than or equal to 2.0 ng/ml, corresponding to a specific activity of > 5 x 10^5 units/mg. |
Molecular Mass : | 25.6 kDa |
AA Sequence : | GLECDGRTNLCCRQQFFIDFRLIGWNDWIIAPTGYYGNYCEGSCPAYLAGVPGSASSFHTAVVNQYRMRGLNPGTVNSCCIPTKLSTMSMLYFDDEYNIVKRDVPNMIVEECGCA |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Resuspend the protein in the desired concentration in proper buffer |
Gene Name | INHBB inhibin, beta B [ Homo sapiens ] |
Official Symbol | INHBB |
Synonyms | INHBB; inhibin, beta B; inhibin, beta B (activin AB beta polypeptide); inhibin beta B chain; Inhibin, beta-2; activin beta-B chain; activin AB beta polypeptide; MGC157939; |
Gene ID | 3625 |
mRNA Refseq | NM_002193 |
Protein Refseq | NP_002184 |
MIM | 147390 |
UniProt ID | P09529 |
◆ Recombinant Proteins | ||
INHBB-1766P | Recombinant Pig INHBB protein, His-tagged | +Inquiry |
INHBB-1762C | Recombinant Chicken INHBB protein, His-tagged | +Inquiry |
INHBB-2261H | Active Recombinant Human INHBB protein(Met1-Ala407), His-tagged | +Inquiry |
Inhbb-1767R | Recombinant Rat Inhbb protein, His-tagged | +Inquiry |
Inhbb-1765M | Recombinant Mouse Inhbb protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INHBB-2612HCL | Recombinant Human INHBB cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INHBB Products
Required fields are marked with *
My Review for All INHBB Products
Required fields are marked with *